CAZyme Information: MGYG000004748_01031

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004748_01031
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515	MGYG000004748_4|CGC1	58339.33	5.0221

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004748	4696076	MAG	China	Asia

• Gene Location: Start: 18123; End: 19670 Strand: +

Full Sequence      

MKMNSFYIAALLVCQVALASCTDYAVKDPNFLPPDVVMNDNTDNDFILEGIPAPGVMQAY
KPSLSGKPYRPITVNYSTEFPPVSKWTPANTRIVGYMGEYRPIVKSEDDYKAIVNKYGSL
TTGAKQAATGRFYVKKVDDRWWIIDPEGYPHYERSVTSMRYGSSARNREAWNKRFGTDAK
WIATSQTELAAIGFHGTGAFCTDTYDKIQAHNASNPDSPLTLTPSFGFLGQFRSQKGYTY
PDNKSDNELGLVLYDGWADFCKEYVNTALAPYLHDANVLGFFSDNEITFSTQNMKILDSF
YNLTDKANPAYLAAKKFMDDKEATTVTDNLNTEFAGQLAEIYYKAVKEAIKEADPGIMYL
GTRLHGTPKYMKNVVEAAGKYCDIVSINYYSRWSPELDTYVKDWATWANAPFLVTEFYTK
GQDSDLNNLSGAGFTVPTQNDRAYAYQHFTLGLLEAKNCVGWHWFKYQDDDGTDNASKPA
NKGVYDNNYEMYPYLAKFMQEVNYNVYNLIEYFDK

Enzyme Prediction     

No EC number prediction in MGYG000004748_01031.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	168	508	3.3e-50	0.554364471669219

CDD Domains     

MGYG000004748_01031 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH57425.1	0.0	1	515	1	516
QDO68502.1	2.43e-312	1	515	1	516
QUT44995.1	3.28e-285	1	514	1	517
QRQ49249.1	3.28e-285	1	514	1	517
QRN00280.1	1.31e-251	11	515	11	517

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T3B_A	7.81e-152	48	515	21	481	ChainA, Glycoside Hydrolase [Phocaeicola plebeius],5T3B_B Chain B, Glycoside Hydrolase [Phocaeicola plebeius]
4BQ2_A	7.17e-16	115	507	245	743	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	1.66e-15	115	507	245	743	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
6XJ9_A	1.45e-09	115	484	264	734	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]
5Z6P_A	2.79e-07	339	484	595	734	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	5.43e-10	117	484	476	924	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000191	0.999824	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004748_01031.