CAZyme Information: MGYG000004747_01838

Basic Information

• Species: Blautia sp900753905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp900753905
• CAZyme ID: MGYG000004747_01838
• CAZy Family: GH94
• CAZyme Description: 1,2-beta-oligoglucan phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1102	MGYG000004747_45|CGC1	125237.62	5.6647

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004747	2765913	MAG	Spain	Europe

• Gene Location: Start: 8619; End: 11927 Strand: +

Full Sequence      

MKMKKINRFLSFTEKNSVYTFLPTGDIFTFLCDDFLINQFRGNAKDGSVNNIYLRIYENG
TPTAYPLLGIQSKSKLSCDKKQLIYQGQIASISYTVTFRPINSMWFWDIALQGEADSIDF
VYGQDLGIGEAGGVYTNELYMSQYLGHSVFSTENGYVVCSRQNMPAKNQFPYIQQGVIGA
RAEHFSTDGLQFFGLSCKETNFPEALSHNLEDRTLQYEFAYTALQTEKFALHGTKNLAFY
GMFLPNHPNAVTKPEFQEEIEEKYAKLLVSPAPSDIHEVEAPKIHPSFGSPYVSPSFTPE
EIQNHFPNRKLEEVNGDTLYSFFTPEHAHVVTKEKELACQRPHGTIIITPPDTDAVNSSL
IASTQYMYGVFNSHVTVGNTDMHKFISTPRGFLNLLKNSGQRLYVKINGTYRLLTLPGLF
EMGMNYSKWYYKLENDVLIVTSYTACHTPDLILEVYSTQHISYDFIVTNQMTQGPNEHIS
DINYEEIPHGLRFSFHTDAYKEITYDMTMPGKTFSIGNDSLFYTNKTPMDETFLTLSLEN
ESQFSLVIQAGLNSLPSTPVPSYKFQEEKDNALEYYRTLTRHFYMETVSPNQKAEILNET
VWWYAHNAMIHFSMPHGLEQPGGAAWGTRDICQGPVEFFLATQHYHLVRNILLNIFSHQN
ADTKEWPQWFMFDRYSMNPGECHGDVIFWPLKATADYINASGDTEILKEILPYDCCPDRK
ESLLEHIKYALSNIEETRFIGDTGLITYAGGDWDDTLQPANEELKQSLVSAWTEALAYQT
FLSLGKAVEETDNILSEKLANLASIVKNAFEHTLTKDGVIAGFLENSSPYHYLLHPSDTK
TGIQYRLLPMTRSIIGELVDQKQAAYNVSLIKEHLKCPDGIRLMDKPAAYNGGISKLFKR
AEQAANVGREISLQYTHAHIRYIEAMAKLGDAREAWDSLFVINPILIQKSVPNACLRQSN
MYFSSSEGDYDNRYDYAENFHLLKTGEIPVKGGWRLYSSGPGIYTRQLISNVLGIRFCPE
GLIVDPVLPEELSGMTFHYDCFQKPLALEYHFIQEGTSYVLDGHSQISSRELSNPYRSGG
LLIPKNILENCSGRLKLYICKH

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	75	1064	1.7e-148	0.9681467181467182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	7.21e-168	21	1080	22	1044	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	6.16e-13	689	945	130	370	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN31622.1	0.0	3	1098	1	1095
BCJ96874.1	0.0	3	1099	2	1100
BCJ99239.1	0.0	3	1099	1	1113
AUS95384.1	0.0	1	1099	1	1115
AIQ20111.1	0.0	10	1099	2	1105

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5H3Z_A	0.0	3	1087	4	1097	CrystalStructure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans [Lachnoclostridium phytofermentans ISDg],5H3Z_B Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans [Lachnoclostridium phytofermentans ISDg],5H40_A Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with sophorose [Lachnoclostridium phytofermentans ISDg],5H40_B Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with sophorose [Lachnoclostridium phytofermentans ISDg]
5H41_A	0.0	3	1087	4	1097	CrystalStructure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with sophorose, isofagomine, sulfate ion [Lachnoclostridium phytofermentans ISDg],5H41_B Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with sophorose, isofagomine, sulfate ion [Lachnoclostridium phytofermentans ISDg],5H42_A Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with alpha-d-glucose-1-phosphate [Lachnoclostridium phytofermentans ISDg],5H42_B Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with alpha-d-glucose-1-phosphate [Lachnoclostridium phytofermentans ISDg]
4ZLE_A	3.90e-12	683	1038	403	743	Cellobionicacid phosphorylase - ligand free structure [Saccharophagus degradans 2-40],4ZLF_A Cellobionic acid phosphorylase - cellobionic acid complex [Saccharophagus degradans 2-40],4ZLG_A Cellobionic acid phosphorylase - gluconic acid complex [Saccharophagus degradans 2-40],4ZLI_A Cellobionic acid phosphorylase - 3-O-beta-D-glucopyranosyl-alpha-D-glucopyranuronic acid complex [Saccharophagus degradans 2-40]
5NZ7_A	1.30e-11	514	1037	411	952	ChainA, Cellodextrin phosphorylase [Acetivibrio thermocellus],5NZ7_B Chain B, Cellodextrin phosphorylase [Acetivibrio thermocellus],5NZ8_A Chain A, Cellodextrin phosphorylase [Acetivibrio thermocellus],5NZ8_B Chain B, Cellodextrin phosphorylase [Acetivibrio thermocellus]
3QDE_A	1.85e-08	560	757	288	485	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q92AT0	1.96e-261	21	1092	16	1074	1,2-beta-oligoglucan phosphorylase OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=lin1839 PE=1 SV=1
P20471	2.68e-12	603	1036	2368	2791	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2
B9K7M6	1.92e-10	560	1034	289	756	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004747_01838.