CAZyme Information: MGYG000004747_00627

Basic Information

• Species: Blautia sp900753905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp900753905
• CAZyme ID: MGYG000004747_00627
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
829	MGYG000004747_9|CGC1	96459.49	4.7083

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004747	2765913	MAG	Spain	Europe

• Gene Location: Start: 47763; End: 50252 Strand: +

Full Sequence      

MIKQLLNQNWFLQKNNCETSFPTAIPTSVYTVLADNNQIPDPYWKDNEDVVRDVIDDDYT
YTCTFSPLPEFLEEDACILRFDGIDTISDVYLNNVLLGHTANMHRTWEFDVTTLLLQGEN
QLKIVLHSPLKAAKEAFAQCPTRGSEDAWEGFSHIRKAHYMYGWDWGAHLPDAGIFRDVT
LLGVKKARIDSVYVTQKHEENKVTLHFAPSFLLPHQLGEELSFENLNKTGNTDFTYTVTV
TDPNGLSQTLQDNPTQMEITSPKLWFPNGLGAQPLYTIKLELYAGNDFVDAWERKIGLRT
LTMCVEKDQWGETFAHVVNGIKVFAMGADYIPEEHLLGKINSFKRRQLLEDAKLANFNSI
RVWGGGYYPDDEFYDLCDELGLVVWEDFMFACSVYELTPEFEDNITQEFIDNIKRLRHHA
SLGLWCGNNEMESFVNDREWVSKPSEVRDYLFMYERIIPQVLKKYDPETFYWPSSPSSGG
SFDEPQDPNRGDVHFWQVWHGNKPFSEYRKYYFRYLSEFGFQAFPSLKTIEEGISDDPQD
WNIFSYIMEKHQRNNAANGKIMGYLQQTYKYPYDFSSMIYASQLLQADGIRYGVEHFRRN
RGRCMGAVYWQLNDCWPVTSWSSIDYYGRWKALHYYAKRFFAPVMISCEEQNWMTASADM
NREHFTFEKSIRLNVTNETFEEKKLTVRWALRNADASVVREEETQVCVAPFSALWLDKVL
LPDADVFHQYVSYEAVENGTVISSGTVIFSYPKYFCYENPNLQLKVEGDEIVIQADTYAK
SVEILNEKENLVLEDNYFDMNGGTKRVKILRGEPENLRIRSVYNIGRIE

Enzyme Prediction     

No EC number prediction in MGYG000004747_00627.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	748	1.2e-100	0.7367021276595744

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.74e-94	6	727	15	704	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	2.07e-15	61	430	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17786	Mannosidase_ig	4.60e-09	671	754	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam00703	Glyco_hydro_2	8.85e-09	187	299	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10150	PRK10150	8.69e-08	68	467	75	441	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY99193.1	0.0	1	828	1	828
QQQ91743.1	0.0	1	827	1	827
ASU31201.1	0.0	1	827	1	827
ANU78391.1	0.0	1	827	1	827
QJU15800.1	0.0	1	827	1	827

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	2.78e-149	5	652	10	662	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	2.94e-149	5	652	12	664	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	3.02e-149	5	652	12	664	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	7.95e-149	5	652	10	662	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
6BYE_A	2.30e-148	22	829	34	842	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	1.67e-106	13	812	19	828	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
A1CGA8	4.98e-104	24	812	31	830	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q4WAH4	1.41e-101	6	658	9	672	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
Q5B7W2	2.62e-101	3	812	6	828	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
B0YBU9	5.30e-101	6	658	9	672	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004747_00627.