CAZyme Information: MGYG000004744_00702

Basic Information

• Species: Megamonas sp900556715
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Megamonas; Megamonas sp900556715
• CAZyme ID: MGYG000004744_00702
• CAZy Family: GH16
• CAZyme Description: Beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
250	MGYG000004744_20|CGC2	28486	4.6213

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004744	2057636	MAG	Denmark	Europe

• Gene Location: Start: 12500; End: 13252 Strand: -

Full Sequence      

MLMALSITPTVIPNSIVTPSIVMAAPASDVKASEAFEVNFQNGMPKGFEASDGWTNGYMF
NVNWHKENVTFDGGNLQLIIDKEKKADKIPYSGGEFRSKDFYGYGKYEVSMKPIKNDGVV
SSFFTYTGPSDNNPWDEIDIEFLGKDTTKVQFNYYRDGKGGHEYLYDLGFDASESFHTYG
FEWHKDKIIWFVDGKEVYRLEGTTIPVTKAKLMMNAWCGTGVDEWLNAFDDKNLPVKAEY
QWIKYTPFTE

Enzyme Prediction     

EC	3.2.1.73	3.2.1.6	3.2.1.8	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	41	244	4.1e-86	0.9805825242718447

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02175	GH16_lichenase	6.36e-114	36	247	1	212	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
pfam00722	Glyco_hydro_16	7.83e-52	64	230	1	160	Glycosyl hydrolases family 16.
COG2273	BglS	2.69e-49	11	247	24	267	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
cd00413	Glyco_hydrolase_16	4.42e-41	61	246	24	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02176	GH16_XET	7.84e-28	60	195	10	142	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BDA09400.1	1.01e-191	1	250	12	261
QIB59261.1	4.09e-191	1	250	12	261
CBL06694.1	1.17e-190	1	250	12	261
SNV04827.1	3.68e-169	3	250	14	261
BAL82171.1	3.20e-122	2	250	14	263

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WVJ_A	1.63e-87	36	247	8	215	ChainA, Beta-glucanase [Acetivibrio thermocellus ATCC 27405],3WVJ_B Chain B, Beta-glucanase [Acetivibrio thermocellus ATCC 27405]
3I4I_A	1.42e-79	48	247	36	233	Crystalstructure of a prokaryotic beta-1,3-1,4-glucanase (lichenase) derived from a mouse hindgut metagenome [uncultured murine large bowel bacterium BAC 14],3I4I_B Crystal structure of a prokaryotic beta-1,3-1,4-glucanase (lichenase) derived from a mouse hindgut metagenome [uncultured murine large bowel bacterium BAC 14]
3O5S_A	9.19e-74	42	246	35	236	CrystalStructure of the endo-beta-1,3-1,4 glucanase from Bacillus subtilis (strain 168) [Bacillus subtilis]
1MAC_A	1.13e-73	45	246	13	210	CrystalStructure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans],1MAC_B Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans]
1BYH_A	6.90e-73	48	246	18	212	MOLECULARAND ACTIVE-SITE STRUCTURE OF A BACILLUS (1-3,1-4)-BETA-GLUCANASE [synthetic construct],1GLH_A Cation Binding To A Bacillus (1,3-1,4)-Beta-Glucanase. Geometry, Affinity And Effect On Protein Stability [Paenibacillus macerans],2AYH_A Crystal And Molecular Structure At 1.6 Angstroms Resolution Of The Hybrid Bacillus Endo-1,3-1,4-Beta-D-Glucan 4- Glucanohydrolase H(A16-M) [hybrid]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DBX3	3.56e-85	31	247	26	244	Beta-glucanase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=licB PE=1 SV=1
Q84C00	8.17e-84	31	247	26	244	Beta-glucanase OS=Acetivibrio thermocellus OX=1515 GN=licB PE=1 SV=1
Q53317	4.57e-82	39	245	577	786	Xylanase/beta-glucanase OS=Ruminococcus flavefaciens OX=1265 GN=xynD PE=3 SV=2
O14412	1.03e-76	23	245	20	240	Beta-glucanase OS=Orpinomyces sp. (strain PC-2) OX=50059 GN=licA PE=1 SV=1
P37073	1.62e-76	54	247	59	251	Beta-glucanase OS=Brevibacillus brevis OX=1393 GN=bglBB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.593580	0.405718	0.000187	0.000227	0.000149	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004744_00702.