CAZyme Information: MGYG000004739_01394

Basic Information

• Species: Actinomyces sp000220835
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces sp000220835
• CAZyme ID: MGYG000004739_01394
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334	MGYG000004739_49|CGC1	33687.57	4.3188

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004739	2692200	MAG	China	Asia

• Gene Location: Start: 8403; End: 9407 Strand: +

Full Sequence      

MGRHSQTSSWSTTLVELGALASKSLPGANTGTHGRRRADGAAKTSVAPMMYRAGGVAAAL
SLAVSGGAYAATQMGDSNVKPLSESQARMAAIGAQGADVTTTESAGMVVEGQSDSVYTVT
EETTEAHGSVEKETDSLPEGETRVETEGVDGVTRTTYEVTAQDGAEVSRVALSSVVVTEK
VDEVVLVGTGSASQPASASTGGGGGDTAAAPADTGGGSSEAAAPAASASGDGTTPEGAQS
IARSLLGSHGWADSEFSCLQSLWNKESGWNYQAQNASSGAFGIPQALPGSKMSSVSADWA
TNPTAQITWGMQYIEGRYGTPCSAWAHSQSVGWY

Enzyme Prediction     

No EC number prediction in MGYG000004739_01394.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07501	G5	8.42e-23	118	189	3	74	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
COG3583	YabE	1.74e-09	118	189	212	283	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEG73677.1	4.58e-121	1	334	1	329
VEG29611.1	1.37e-118	1	334	1	322
AVM62044.1	6.93e-116	1	334	1	310
QQO78798.1	9.18e-116	1	334	1	308
CED92494.1	8.54e-115	1	334	1	312

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996958	0.002952	0.000044	0.000019	0.000011	0.000012

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004739_01394.