CAZyme Information: MGYG000004737_01598

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella
• CAZyme ID: MGYG000004737_01598
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505	MGYG000004737_22|CGC1	55748.48	4.9543

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004737	2424391	MAG	China	Asia

• Gene Location: Start: 23228; End: 24745 Strand: -

Full Sequence      

MASSNAEHPKHDWRPAFHITVPNGALNDPNGLCQIDGTYHVFHQYTPSWPARGVCWAHWT
TRDFRTWEFHGSPIHPDGDLDRNGSYSGSAVVRDGRMWCYLTGNVKEPGDYDYDFAGRKA
NELLCVSDDGDHFDGKRLVLSNADYPAYCSNHVRDPYVWEQGGEYHMLLGVRTVENRSAV
ILYHSRNGIDWQMEGSLSTVGERPLGYMWECPGRIAVGGRQYLLVCPQGVPKRDLAFQSI
YNCGVFPLQRDLVEMARGDSGRMEASGPQRVLDPASFVELDYGFEFYAPQAFTDESGRTI
LMGWVGLPDVVGEYDDPTQAWKCSITVPRELSVNAAGRLCQWPVAEVDALRGERVDLTPE
GAHGSSGLIGSSPYDMVCMDGAVGATVPGCQLDLLVSDIRGEGRICLNADLELSVVGQTV
ELAFLRRSGRGRGVRRVPLSALSEGALRSVRVLVDTSVVEIFLNGGEVTLTTRWYPDRVD
RLGVSSTFGGDHSAWLLDGWTFAGV

Enzyme Prediction     

No EC number prediction in MGYG000004737_01598.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	18	343	6.4e-78	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	3.28e-125	24	334	1	288	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	2.05e-112	13	477	13	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	1.66e-99	12	490	27	473	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
smart00640	Glyco_32	5.46e-79	18	466	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	1.52e-78	18	343	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADK67554.1	6.38e-223	1	505	1	504
AKT48815.1	2.56e-200	1	505	1	503
ADK68496.1	1.31e-126	13	497	27	522
AKT49659.1	1.88e-121	13	477	6	461
QNM06260.1	2.52e-108	13	486	28	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	1.15e-52	13	500	25	483	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
6NU7_A	1.51e-47	17	475	36	462	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7BWB_A	2.73e-39	13	477	48	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
3PIG_A	1.50e-37	13	481	39	491	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]
6NUM_A	3.48e-37	13	481	39	491	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13394	2.15e-74	15	482	38	460	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
P07819	1.66e-71	14	476	29	454	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P27217	9.09e-71	15	497	28	460	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
Q05936	4.03e-61	12	478	32	466	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P16553	1.42e-60	13	497	23	475	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004737_01598.