CAZyme Information: MGYG000004735_01988

Basic Information

• Species: UBA7160 sp900757145
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA7160; UBA7160 sp900757145
• CAZyme ID: MGYG000004735_01988
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
600	MGYG000004735_16|CGC1	69385.75	5.3819

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004735	3188924	MAG	Spain	Europe

• Gene Location: Start: 7680; End: 9482 Strand: -

Full Sequence      

MDIKKVVKSLNVYTVKKGIAYLRQYGWKEFRVRLSERFEGIETDYGEWCKKDILSEEERQ
RQRDMVWEHPPLISVVVPVFSTPETFLRQMIESVTAQTYPHWELCIVDASPDVSVTKPVI
AEYLTDARIRYKILGENLGIADNTNKAFEMAKGDYIALFDHDDLLCENTLFEVALAIQER
GADVIYTDEDKIKGETGERYQPNFKPDFNLDLLRSNNYICHLLVVKKELLECVGGLRREY
DGAQDHDFILRCAEKTEKIAHVPKVLYHWRVHASSTADNPLSKKYAFDAGKHAVEDHIRR
CGAQAEVTDTKFPGFYRAKYKVEGNPLVSILIPNKDERETLRACLDSIQKTSSYRNYEII
IIENNSTEQETFEYYNEIDGRDGVRVVYWKEGFNYSALNNFGFTFAKGDYILCLNNDITV
ITPDWLERMIGQCQRQEVGIVGARLYYPDDTIQHAGVIVGIGGVAGALFVGMPRERSGYL
RKAILQQDLSAVTAACMMVDRHAWEAVGGFEEKLAVAFNDIDFCLRIRQKGYLVVYEPNA
EMYHYESKSRGYEDTPEKQMRFKSEIDFMQERWKQFLEDGDPYYNPNFSLKTCDYSLKKR

Enzyme Prediction     

No EC number prediction in MGYG000004735_01988.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	74	231	1.9e-23	0.9764705882352941
GT2	329	503	5e-23	0.9647058823529412

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	5.94e-104	71	271	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	2.82e-41	330	546	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06433	GT_2_WfgS_like	3.91e-30	74	276	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	9.42e-30	324	551	1	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	5.06e-21	74	202	1	128	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB58022.1	5.53e-269	5	598	10	605
QMW77454.1	5.53e-269	5	598	10	605
QBE99393.1	1.29e-267	5	598	10	605
QNM10257.1	6.40e-267	5	600	8	604
QQQ92271.1	2.66e-262	5	598	10	605

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BCV_A	5.76e-06	71	192	5	124	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	4.04e-149	68	597	363	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	8.03e-106	43	599	291	842	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	3.42e-13	71	283	8	222	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
P71057	4.61e-12	71	290	4	230	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
O32268	1.45e-10	71	187	6	121	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004735_01988.