CAZyme Information: MGYG000004723_02035

Basic Information

• Species: Acutalibacter sp900548545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter sp900548545
• CAZyme ID: MGYG000004723_02035
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
593		66163.24	5.6

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004723	2308372	MAG	China	Asia

• Gene Location: Start: 1613; End: 3394 Strand: -

Full Sequence      

MARKKAEPAKKSAAPIEAATPSVEKDVPVTEPTGPVKEAAPATKKTAATRKRAVPKKAAS
TRKKATPAAVETTPVAKGPVPVAEEAAPVAKEPTPVAEEAPALEVQTDLPRRSVAFIGSE
CHPFVKTGGLGDVMYALPRELVRLNCDVRVILPRYACIPQKYQEKMIYRGEFYMDLGRTG
REYYVGIMEYICDGVVYDFIDNQEFFSSGNPYINLVDDIPKYCFFSKAALAALNFMNWIP
DIIHCHDWQAALVPVYLRTLFQDSPVGRARSILTIHNLRFQGIYNIPTIQYWSGLPDSVF
NMGALKQDYNDANMFKGGLAYADRITTVSSTYAQEIQTSEYGETLEGHLRYHSGKLRGIV
NGIDYGMWNPETDPALAVNYGLGNVLDRKMEDKLALQKELGLEEDPSKFVIGLISRLTNQ
KGLDLVNAIIPQVLDGNTQVVVLGTGDKQYEDAFRYYEDTNRGAFAACIQYDEARAHRIY
AGADALLVPSRFEPCGLTQLNAMRYGTIPIVRETGGLKDTVEPYNTFTGDGNGFTFDRYE
PGLLLDAINRAKTIYFDNRSHWDEVVQRDMAKDVSWENSAKQYKDLYLELTPW

Enzyme Prediction     

EC	2.4.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	114	587	1.2e-174	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02095	glgA	0.0	114	590	3	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	114	589	2	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	0.0	114	590	3	463	glycogen synthase GlgA.
COG0297	GlgA	0.0	114	587	3	475	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	2.34e-121	117	591	9	480	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC04956.1	1.13e-267	111	591	24	505
SDR77824.1	1.89e-266	111	591	269	750
BBH27847.1	4.25e-262	110	591	265	746
QUF81048.1	1.41e-260	106	592	219	706
BCL59191.1	1.06e-259	110	592	182	664

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	1.09e-89	114	590	3	476	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	3.80e-89	114	590	3	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	2.92e-88	114	590	3	476	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
6GNE_A	6.39e-86	114	587	12	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
1RZU_A	3.68e-85	113	590	2	475	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C4Z0G2	1.29e-169	112	590	2	478	Glycogen synthase OS=Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4) OX=515620 GN=glgA PE=3 SV=1
A9KMA3	1.78e-156	112	590	2	478	Glycogen synthase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=glgA PE=3 SV=1
B2V049	8.75e-135	114	591	3	476	Glycogen synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) OX=508767 GN=glgA PE=3 SV=1
B2TR28	6.98e-134	114	591	3	476	Glycogen synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) OX=935198 GN=glgA PE=3 SV=1
A6M334	1.02e-133	114	591	3	476	Glycogen synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) OX=290402 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004723_02035.