CAZyme Information: MGYG000004723_01358

Basic Information

• Species: Acutalibacter sp900548545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter sp900548545
• CAZyme ID: MGYG000004723_01358
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
690		79754.51	4.7387

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004723	2308372	MAG	China	Asia

• Gene Location: Start: 9630; End: 11702 Strand: +

Full Sequence      

MAQDQRFPFPITGKTFIGVDPTDLKQRGLLPQEVIVPAWFGFVTEISQLPTTCPIEVTGR
SQYKLFVNGTSVLFGPCRSQREIAYYDTLDIAPYLKVGRNTLVLQVMSYPEHPENRSQAG
PNYCYGDDGGPAISVEGVLGDKDPSKPENWLIWLDKGMTFSDDGVFLTGATERVDGRLSC
LNPFLSEKWECPDLLQAVYRQPWAYDPFGCCHGEVFLPRPIPLLYRREYCFPNWQRNEVP
AGEKRRFVLDAGRLTTAYFRIGLQGGRGAKVRILYAESYFQRREDGSVYKGVRDDPSGFL
DGMYDEILVGSSGVYEPFRFRTFRFVEITVEAGEEPLTLLPQPYIETAYPLENTKRPQFK
NTREQRLYDVAFRTLQLCVHDTYEDCPYYEQLQYACDTRLEILFTYASTDDKKLPAYAIQ
LFASSLESNGFTQARFPSRESQIIPVFSLYFVMMLEDYVRETGDLNYIRTFLPIAERVIE
KFLSNRCPDGLLAPNGYWDYFDWTRQWSDVASVPTAVKDGESVLQNLFFVYATQSFIRLL
QRFGRWNQAAEYAEECNKLLDLVEQLGYDCDKGLYREGPRTDEYSQHTQIYAVLTGLVKG
EQARKIMERVLADPTLVQCSFMQNFYLFRALEKVGMYDETLKLWDKWESFLQLHCTTFPE
TPFDPRSDCHGWSALPLYEMSLKRLKDMED

Enzyme Prediction     

No EC number prediction in MGYG000004723_01358.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	244	681	2.7e-75	0.8551587301587301

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17167	Glyco_hydro_36	2.47e-09	449	610	129	299	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
pfam17389	Bac_rhamnosid6H	6.44e-08	365	680	14	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	1.67e-04	448	565	341	459	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam05592	Bac_rhamnosid	2.35e-04	246	334	7	90	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3459	COG3459	4.92e-04	457	617	680	864	Cellobiose phosphorylase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS28317.1	2.53e-152	11	681	7	711
QTH43327.1	1.92e-132	55	679	46	711
QJD82735.1	2.80e-130	55	679	50	696
BBH24613.1	2.97e-128	55	679	47	715
QTH40607.1	8.11e-127	56	681	47	691

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	2.35e-31	310	678	493	870	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	1.46e-17	348	678	205	536	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004723_01358.