CAZyme Information: MGYG000004721_01526

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004721_01526
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
581		66010.58	7.2036

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004721	2389811	MAG	Denmark	Europe

• Gene Location: Start: 550; End: 2295 Strand: -

Full Sequence      

MKKLSLFILGAAFTFMGKAEVPLVWQSDTAHIRMDELKRAYISPSRIVWSKGLTGTDVLL
QRGTGQPEMGRRHTALMKSGEADTASVIFDYGRELHGGLQLVMGSSSRRMPSKVRIRFGE
SVQETCSEPCNSEWKMGFSTDDHAMRDIVMDIPRDGKIEIGNTGFRFVRIDLLQPNTQIS
LREATAVFRYRDMSYVGSFKCDDERLNKIWMTGAYTVHLNAQEYIWDGIKRDRLVWLGDM
HPEVSTFSAVFGYNDVIPKSLDLACKQFPLPSWMNNMTSYSMWYLIIQWEWYLQNGDRQF
LEKHRPYILGLIDRFVDTVDEKGKINGNYFLDWPSSPNKKGVEGGVRAQLVWAMKDAQRI
CQVFGEQEYAAKCQRIIDIEMKHRPEHNNLKQAAALMTLAGLLKPEPAFNKILSKGHADG
FSTFYGYYILEAEAMAGAYDEALSVISDYWGGMLDMGATTFWEDFALDWMKDTNPIDQLG
DRNKKNIHGDFGGYCYPGFRCSLCHGWASGPTAWLSHHVLGVEILEPGCKALRITPHLGH
LKWVEGTYPTPFGPVKIRHEKRADGTIATSVDAPKEIRIVQ

Enzyme Prediction     

No EC number prediction in MGYG000004721_01526.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	84	577	4.6e-95	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.98e-14	196	519	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.36e-04	521	574	1	54	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEL04122.1	7.30e-263	19	581	22	592
AWI10121.1	5.60e-261	6	581	13	595
BCA48698.1	3.68e-260	16	579	20	588
QUT69834.1	1.05e-259	14	579	16	588
QUT42018.1	4.26e-259	14	579	16	588

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	4.35e-46	34	569	142	686	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	9.26e-16	86	514	94	536	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000259	0.998984	0.000258	0.000164	0.000151	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004721_01526.