CAZyme Information: MGYG000004719_01479

Basic Information

• Species: Roseburia sp900756925
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia sp900756925
• CAZyme ID: MGYG000004719_01479
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
812	MGYG000004719_25|CGC1	89674.75	4.8252

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004719	2432384	MAG	China	Asia

• Gene Location: Start: 31462; End: 33900 Strand: +

Full Sequence      

MSLLGKNNTYQDASLKAEERARLLLDELALEEKMAQINSVFPFDQKAKDFEWIRSQVPYG
IGEVSTLEMRQIKTLEEAAQWVKEVQKIVMENSPHHIPAVFHMEGLCGAFIQEATSFPSG
IARGASFDPELEQEIAACVATQEVACGVTHILAPVLDISRDSRMGRQGETYGEDPALASA
MGVAYTKGAQGVEVNGRHAESVAKHFLAFHNSQGGIHGTHSDTPERLLQEIYGKPFQAAI
QEAKLKGIMPCYCSIDGEPASVSHKLLTELLREQMGFDGVCVSDYGGIANSHNCQRIGET
MAETGAMALEAGMDVEMPDPNGYGKELMEMFRQKKADMALLDQAVYRVLCAKFRMGLFEQ
PYPLLGDELLAVYKKADDGKRTTRKSAMESVVLLKNDGVLPLDKANKKKLALIGPHAVNA
RMFFGGYTHMTMMESIYAVANSIAGVSGIENLTGEEIQVVPGTNIQLDQGEKYDAILRTQ
KPECRSLEEYLKEYLPDWEIKYAKGYQIAGEDDTLFEEALQLIRESDMAILTLGGKYGTC
SLASMGEGVDGADINLPKCQDDFIRRAAEENTPLIGVHIFGRPISSDVADEYLNAIVEAW
NGAECAAEAITKTLFGENNPAGRLPVSVAYNSGQIPVYYNHPNGSAEHQSGSIGFANYVD
LPHRPRYCFGYGLSYSAFRYQDLEIPETEVEPFGEISLSFTVENTSERAGDEVVQIYLSD
CFASRTRPVKELAAFRRISLKAHEKKTIRCQIAASQLAFLDKNMKWKIEKGDVDILIGAS
SEDIRLRSNVHICEDAWIEGRNRAFYGKAEVL

Enzyme Prediction     

No EC number prediction in MGYG000004719_01479.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	91	318	3.9e-58	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	9.51e-119	86	785	93	758	beta-glucosidase BglX.
COG1472	BglX	4.15e-69	33	417	6	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	3.21e-59	33	349	5	314	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	3.47e-50	111	744	108	734	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.99e-32	391	675	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV22852.1	0.0	10	809	8	814
CBL11432.1	0.0	10	809	8	814
QRT50982.1	0.0	10	809	8	814
AJG98232.1	0.0	8	808	6	802
AIQ70324.1	5.10e-312	10	808	8	802

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	7.51e-96	7	785	33	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5YOT_A	6.97e-94	10	795	7	759	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
5XXL_A	1.69e-93	24	785	17	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
7EAP_A	5.07e-93	10	795	7	759	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5XXN_A	8.81e-93	24	785	17	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	3.06e-102	74	782	45	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	1.64e-92	6	788	25	751	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
Q56078	7.56e-91	24	785	41	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	2.05e-89	24	785	41	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
P14002	7.62e-71	114	792	67	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004719_01479.