CAZyme Information: MGYG000004719_00503

Basic Information

• Species: Roseburia sp900756925
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia sp900756925
• CAZyme ID: MGYG000004719_00503
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
853	MGYG000004719_6|CGC1	98272.31	4.9352

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004719	2432384	MAG	China	Asia

• Gene Location: Start: 25988; End: 28549 Strand: +

Full Sequence      

MIQAINLKIAYMKNPIGIDEKNPVLTWKCRDAIKQSAYEIEYNVQSFGAECRETKIIRAN
TDIMEFQFEDNFKSRDIVSCRIRLTNENGIQGEWSEYATFEMGLLEKSDWKATFIMGDYD
HEKNPKMRYPVDYFRKKFTLSGKVKHARLYMTACGLYETYLNGEKVGDQVFAPGATAFQK
RAHYQVYDVTEMFSQKTNSWTIELADGFYASKTGVFGKAKTYGHEPKVMGQLEIVYEDGT
VEDVCTDEKFEWSNDGPIRLADMKDGEIVDYSCTPSYSGNARTTQYDGILCASNNVPVRE
QERFANPTIIKCPDGHTVLDFHQNIAGYVETTLCGATGKKGQMLFVEKWDENGNFTYKNI
SWEGEYDTCHFQTVDIICDSNKHVYKSKFTVMGFRYVLLLEWPEEIKPENFTAIAVYSDM
DTSFEFASSDNMLNQIVKNTFWSVKGNFLDVPTDCPTRERAGWTGDAQLFFNTGNYMMDQ
RSFFHKWLQDVVDSQKENGLIYNINPSNPNNPQILEWLSVEGGAGWGDALIMIPYYYWKR
YGDDSLMKKFWEPMKKCFEFYKGRMGKRNLLSLLYPPRTKFDKYLCACGRDFGEWTEPED
CAPSQYKMMIPMAEEATAYLSYDAALMSEMAMYIKENDLADEYKKIAEKTKESYNYYFVK
DGKIETNRMCKFVRPCGLKLVDDKVRSVLLSQIVKLNRERDYKIGTGFLTTPFVFECLSE
AGESDDAYRMLVNPELGWVQQINNGATTVWENWTDDASLNHYSKGACCQWIFDTVCGIKL
SEQKNHFIIKPHLVSDLDEIEMSYDSVYGKVVSGWKRVDGSVRYHIVIPANTEAEVTLPG
EETRVLCAGKYDL

Enzyme Prediction     

No EC number prediction in MGYG000004719_00503.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	309	838	1.1e-135	0.998015873015873
CBM67	123	270	9.2e-23	0.7727272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.54e-81	421	775	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.28e-41	142	302	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	4.82e-18	786	842	11	67	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	1.07e-12	310	417	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL26979.1	0.0	1	852	1	846
QZN73695.1	3.46e-264	1	851	1	853
QFJ55302.1	1.98e-236	2	853	1	863
AHF25263.1	1.12e-228	2	849	1	840
ADP81465.1	5.51e-207	2	852	1	859

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	6.33e-101	6	839	34	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	3.57e-91	135	841	306	997	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.35e-89	13	841	13	849	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	2.46e-101	13	846	45	886	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.89e-94	14	839	42	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	1.62e-90	135	841	306	997	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	1.17e-74	14	846	42	914	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004719_00503.