CAZyme Information: MGYG000004718_00132

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Anaerotignaceae; Anaerotignum
• CAZyme ID: MGYG000004718_00132
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
273	MGYG000004718_3|CGC1	29947.62	6.1121

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004718	1910069	MAG	China	Asia

• Gene Location: Start: 29592; End: 30413 Strand: +

Full Sequence      

MLPVQSTQHATVSGNVYQTKQPDTTTFSDVMQGTSATQSLDTIFDKAARTYDIPVSLLKA
MAKVESNFNPKAVSGAGAKGVMQLMPATAKSLGVSDAFDPEQNIMGGAKYISQMLDRYDG
NTALALAAYNAGSGNVKKYGGIPPFKETQNYVKKVMRYAGENLTAGTYTPSTKPRHDTTV
ANQTTRQNNVEQSIMHFTDFTEMDYLIFIESLKHRASMSLSDVLNGVTQNNTYQDTENIF
DMAFEKNPLTDLSAGIFADTTNLMGNRFQKLYE

Enzyme Prediction     

No EC number prediction in MGYG000004718_00132.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	55	169	4e-38	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	1.03e-55	56	160	2	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	6.38e-50	43	159	9	146	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	3.21e-47	46	158	10	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	3.71e-42	44	158	1	155	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.60e-41	44	151	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CUH92175.1	1.80e-60	25	167	27	166
QOX65397.1	1.90e-59	39	227	69	241
BCJ97806.1	2.49e-58	37	166	37	166
QIB69633.1	4.52e-57	39	163	67	191
QHI71370.1	1.39e-56	28	163	57	192

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	4.15e-14	46	165	455	598	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
1QSA_A	4.18e-14	43	158	456	594	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
5OHU_A	4.24e-14	46	165	484	627	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
1SLY_A	5.63e-14	43	158	456	594	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
6FC4_A	1.02e-13	46	165	456	599	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	8.31e-48	39	155	59	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	7.75e-41	13	167	1392	1549	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	7.75e-41	13	167	1392	1549	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	6.24e-20	47	174	14	132	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
A0L862	1.54e-16	43	136	288	387	Membrane-bound lytic murein transglycosylase F OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) OX=156889 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004718_00132.