CAZyme Information: MGYG000004717_01243

Basic Information

• Species: Megamonas hypermegale
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Megamonas; Megamonas hypermegale
• CAZyme ID: MGYG000004717_01243
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349	MGYG000004717_56|CGC1	40337.44	8.9125

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004717	2016868	MAG	China	Asia

• Gene Location: Start: 1373; End: 2422 Strand: +

Full Sequence      

MIKKFLFICICFMVCLANFSVGLCVSKNSDTNKKINLVWQPVLDNENDLSQIKELSGVNI
VSPSWFVIERADGHIKDNGDFLYARDVKKKNYKIWPLITNDFNAEMTHKWLNDKKARAYI
IKQLVFYAQRYPIDGYNFDFENIYDKDRDALSSFMEEATSALHKEGILVSMDITVASNTP
NWSSCYDREVLGKTVDYLVLMAYDEHGRLSKTAGSVASIGWVENGVKNLLEQVPPEKIIL
GIPLYMRLWEQSDDGKVSASTLNMMQANNLKKEKNVKTIWLPTLGQNYFSYRENGKTYHV
WQEDKKSLQLKVALVNKYRLAGVASWRKGFETKDIWPMIDKELKKKYNN

Enzyme Prediction     

No EC number prediction in MGYG000004717_01243.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	87	333	3.9e-39	0.7736486486486487

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	1.51e-89	42	339	9	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	8.62e-58	27	336	96	415	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	2.51e-37	49	336	17	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
smart00636	Glyco_18	8.00e-31	66	326	33	329	Glyco_18 domain.
pfam00704	Glyco_hydro_18	4.53e-25	111	326	83	302	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNU93874.1	2.79e-252	1	349	1	349
BDA10778.1	1.40e-164	21	345	19	348
QIB60827.1	2.82e-164	21	345	19	348
CBL05325.1	8.70e-130	21	281	10	275
BBB92123.1	2.42e-103	34	344	165	478

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	1.25e-23	58	327	26	307	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
5JH8_A	3.73e-21	59	343	26	314	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4S3J_A	2.19e-20	70	339	144	421	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4S3K_A	5.54e-20	102	344	182	428	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4WIW_A	3.22e-19	31	344	1	349	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32258	4.53e-38	58	344	52	344	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
O31682	1.87e-27	49	249	16	212	Putative glycosylase YkvQ OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvQ PE=3 SV=1
P37531	3.96e-26	88	343	160	423	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
O05495	2.60e-23	58	327	118	399	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P0DPJ9	3.46e-20	70	339	143	420	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.074197	0.576799	0.347827	0.000403	0.000320	0.000433

TMHMM  Annotations     

start	end
5	24