CAZyme Information: MGYG000004707_00546

Basic Information

• Species: Monoglobus sp900554105
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; Monoglobus; Monoglobus sp900554105
• CAZyme ID: MGYG000004707_00546
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MGYG000004707_10|CGC1	42344.1	4.6399

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004707	1967109	MAG	Denmark	Europe

• Gene Location: Start: 25479; End: 26579 Strand: -

Full Sequence      

MDLVYKDHTALEYAEMACDTLMKKFNAEDLPPKGRFHYHQGVFLSGMQKTYELCGDEKYY
NYIKAWVDSIIDENGTITKFDKTQLDDMEPGVLLFMLYEKTGDERYKTALDTLLPLIKDF
PKNPEGGFWHKGRYPQQMWLDGLYMAGPICSEYAKVFDKPEYFDLTAFQVLMMEKKTIDK
ETGLWYHAWDYAKEQPWANPETGHSPEFWGRSIGWVPVAIFEDLGYFPDDYKDKPEMVRA
ATDLLKAVVKYQDPETGLWYQVVDKGYDKNNWLESSCTCLFVSALCRAVKEGYMDQSYLE
YAKKGYEGIINRLKYDENGVIIDNICIGTGVGDYEHYLGRPTSANDLHGAGAFILMCVEV
YKAFHE

Enzyme Prediction     

No EC number prediction in MGYG000004707_00546.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	31	362	1e-111	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.14e-115	8	364	6	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.99e-107	13	364	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ92567.1	4.69e-196	9	360	4	355
BCJ93957.1	2.86e-175	6	363	5	363
QNK55786.1	1.92e-168	9	363	9	363
AZK46659.1	6.35e-167	9	363	9	363
AEI40556.1	7.06e-167	9	363	9	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	1.91e-120	1	366	4	370	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.11e-119	11	366	4	360	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	2.15e-81	12	359	3	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3QWT_A	3.19e-29	36	356	65	373	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	5.05e-26	36	364	66	382	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.04e-119	1	366	4	370	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.40e-22	145	359	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.40e-22	145	359	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004707_00546.