CAZyme Information: MGYG000004703_01316

Basic Information

• Species: Prevotella sp900556275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900556275
• CAZyme ID: MGYG000004703_01316
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
687	MGYG000004703_41|CGC1	76701.78	7.8577

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004703	2398084	MAG	China	Asia

• Gene Location: Start: 6822; End: 8885 Strand: +

Full Sequence      

MRIKAITAALLCAVTAHAKGDNGPMKLVPVENVKVADAFWTPRYDNWFKVTIPDVLNKFE
GRGTGNNQGNTLDNFDQIASGIRNTGHHVGEPWFDGLVYETIRGVADMLKQRRDPAIEAR
IDMYVDKIAAAQASDKDGYLNTYTQLMYADKRWGEHGGLLRWQHDVYNLGALVEAGVHYY
EATGKTKLLVAATRAANMMCGYMGEYPRHNVVPAHSLPEEAMVKLYWLYRDRPEAAKQVN
AQGVNVDKNEYLRLATFWIEHRGVHCGYPQWGTIGNEAAERWIRDNKYTDPKYGNHSRPS
FGPYAQDSLTLDRQNTIEGHAVRATLYMTGVTTAAIETHNPMYIAAARRLWDNMAGRRMF
ITGGVGAIAYDEKFGGDYFLPNDAYLETCAAVGVAFYSQRLNQLTCDARYMDEFERSLYN
NVLTGISLAGDNYTYQNPLDGDHHGRWQWHGCPCCPPMFLKLVSAMPGFAYGYDKNSVYV
NLFIGSQARIDDMKLSISQATAYPSNGQVAITINPDKSKTFTLKVRIPGWAVGKENPFGL
YNSTPATRPILMVNGQEVETTIVNGYACIDRKWNKGDVVSLSLPVEPRYVTAHNAVNDLK
GMTAIAAGPIVYSFEECDNKDVKHLKVDTKGKLAMNRTTQFGSPVNIVSGDGVDARGNKV
TFRAVPYFAVGNRHKGEAYKVWAEESR

Enzyme Prediction     

No EC number prediction in MGYG000004703_01316.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	33	612	8.5e-165	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	7.23e-148	32	613	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	5.00e-117	28	682	12	584	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ43239.1	1.06e-299	19	682	21	684
BAD47118.1	1.06e-299	19	682	21	684
ANQ62633.1	1.31e-299	19	682	27	690
QCQ38914.1	1.50e-299	19	687	21	689
QCT80146.1	1.50e-299	19	682	21	684

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	1.72e-101	24	682	6	622	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	2.88e-92	32	685	15	647	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	4.42e-90	32	685	15	647	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	2.11e-66	30	687	41	698	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	8.62e-57	32	677	2	651	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	4.72e-56	32	677	2	651	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000244	0.999117	0.000172	0.000167	0.000150	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004703_01316.