CAZyme Information: MGYG000004699_02945

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium
• CAZyme ID: MGYG000004699_02945
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
195		23403.81	8.5809

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004699	3820928	MAG	Germany	Europe

• Gene Location: Start: 19; End: 606 Strand: +

Full Sequence      

MIRDLDAIAYELNKFKEKKIPILWRPLHEACGGWFWWGSKGPEIYIKLYRLMYDRYVNYH
KLNNLIWVWNSPKKEWYPGDDVVDIYSVDYYAPIGNHGPLTNEYLKTAESEQANKAIALG
ENGPIPDPKLLKKTKTPWLWFMTWNNFNNNFMWNTQDELRRFYDDAYVINSEDLARLRNK
YKVDENMKAVAIYMK

Enzyme Prediction     

EC	3.2.1.4	3.2.1.151	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	2	172	7.4e-62	0.5643564356435643

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.28e-38	1	173	132	311	Glycosyl hydrolase family 26.
COG4124	ManB2	5.64e-15	3	91	162	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAA34445.1	1.37e-86	1	182	275	452
ADL51691.1	1.03e-72	1	174	276	448
BAV13096.1	1.03e-72	1	174	276	448
AGA58379.1	1.11e-65	1	174	314	488
AJS61604.1	1.89e-64	1	174	264	438

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	5.55e-52	1	179	275	452	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	1.85e-50	1	145	137	280	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
6Q75_A	5.23e-37	3	174	151	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3WDQ_A	1.28e-34	1	146	174	320	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	2.74e-28	4	147	176	317	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	4.78e-56	1	174	304	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
A2R6F5	2.47e-46	1	169	159	328	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
Q5AWB7	1.85e-43	1	145	177	320	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	1.05e-38	1	179	285	462	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55298	5.32e-35	1	174	289	459	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004699_02945.