CAZyme Information: MGYG000004698_02318

Basic Information

• Species: Prevotella sp000436695
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000436695
• CAZyme ID: MGYG000004698_02318
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
965		104382.66	4.5007

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004698	3424026	MAG	Denmark	Europe

• Gene Location: Start: 3625; End: 6522 Strand: -

Full Sequence      

MKRINKLFCALLTGVLAMNANMAGAQNWNFKSTPSDDEANLKADSKNWKYDSTNDRYSNL
NALNGALTANGQSLKMTDGLTFEESETDGLRIDVDKRLILNKKGTITIVGLKEGQVVTVE
GTSSHKTTARSITATNLAGTTGFDQKVTMETTLTCTGTVEADGDVTISNPDGGFYLYSIN
VKDESEVTPPVSSYNDVPLNTAKNQMVLTLGSEVKYYNTDDVNVAFNREAGTVTVTPNAG
TWQDVYTKTVNSISFALAKDDTEGGEVSEGDVKIKTYSGWFETAYIEWELLSGASSYNVY
VKGGSVGSEYTKIDYQLVRKYKSYGRADVPGLSAGTYSLKVVPVISGNEDESKACSVDGI
EVKGHDRTGFAFANGKAPGAYNNDGTLKKNAVVIYVTDENKDDITLDVVTSSKGAVTSCK
GLQTILNSIKKGYDSRVFVFRMIGQVSVPADADKGDIVIDMGGKKASPGITFEGIGNDAV
ADGWGLRVKNASSVEIRNIGFMNCSSSEGDNVGLQQDNEYVWVHNCDMFYGNAGSDADQI
KGDGALDCKKSNYITFSYNRFWDNGKACLLGLSGENDKMYITYHHNWFDHSDSRHPRIRS
YSAHVYNNYFDGCAKYGVGSTNASSVFVENNYYRNTNRPMMISMQGTDVAFGDGTFSSED
GGIIKSYGNAFAEKSSKFSFITYQQDNVEFDAYEASERNEKVPSSVKTKKGGTTYNNFDT
DPSIMYEYTPDPANEVVSVVTGKYGAGRLQHGDFQWSFNNSVDDSSYDVNKELKSAVTNY
KTTLVGIFDGSNDESGNQGGGETTEPGGNEGETGETTGGETTGGNEGETGGDEGEGEGTE
TPVTGDVITCSFGENKSYSNTAFFTISGNTSGTKGTITVDGTAYEYCLKMESSTSIKFTT
TEDMTLKLYFGKKDNHNINIDGNKEEAVAEGDHYVLTYSLPAGQHELTKANTANLYLIML
VPAGK

Enzyme Prediction     

No EC number prediction in MGYG000004698_02318.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	465	637	6.4e-44	0.8316831683168316
CBM77	859	956	2.9e-24	0.9029126213592233

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3866	PelB	1.77e-50	471	750	104	345	Pectate lyase [Carbohydrate transport and metabolism].
pfam18283	CBM77	1.07e-32	848	958	3	108	Carbohydrate binding module 77. This domain is the non-catalytic carbohydrate binding module 77 (CBM77) present in Ruminococcus flavefaciens. CBMs fulfil a critical targeting function in plant cell wall depolymerisation. In CBM77, a cluster of conserved basic residues (Lys1092, Lys1107 and Lys1162) confer calcium-independent recognition of homogalacturonan.
smart00656	Amb_all	7.21e-31	471	637	19	190	Amb_all domain.
pfam00544	Pec_lyase_C	7.02e-21	445	633	5	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73893.1	1.91e-219	274	964	25	685
AWK03841.1	3.71e-213	272	964	21	742
ADL35105.1	6.36e-208	278	961	63	748
QSW91132.1	8.50e-200	273	961	21	824
QHJ07965.1	5.75e-198	272	958	21	666

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	8.93e-24	470	635	81	248	Crystalstructure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
3ZSC_A	1.67e-18	471	749	71	331	Catalyticfunction and substrate recognition of the pectate lyase from Thermotoga maritima [Thermotoga maritima]
1AIR_A	1.68e-15	464	748	85	342	ChainA, PECTATE LYASE C [Dickeya chrysanthemi],1O88_A Chain A, Pectate Lyase C [Dickeya chrysanthemi],1O8D_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8E_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8F_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8G_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8H_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8I_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8J_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8K_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8L_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8M_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1PLU_A Chain A, Protein (pectate Lyase C) [Dickeya chrysanthemi],2PEC_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi]
1VBL_A	3.85e-15	474	633	138	330	Structureof the thermostable pectate lyase PL 47 [Bacillus sp. TS-47]
2EWE_A	4.04e-15	464	748	85	342	ChainA, Pectate lyase C [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GCB2	6.33e-23	470	641	110	280	Pectate trisaccharide-lyase OS=Bacillus licheniformis OX=1402 GN=pelA PE=1 SV=1
Q65DC2	6.33e-23	470	641	110	280	Pectate trisaccharide-lyase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=BLi04129 PE=3 SV=1
B1B6T1	6.33e-23	470	641	110	280	Pectate trisaccharide-lyase OS=Bacillus sp. OX=1409 GN=pel PE=1 SV=1
Q5AVN4	2.67e-20	474	653	104	288	Pectate lyase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyA PE=1 SV=1
Q4WIT0	1.46e-19	447	649	66	274	Probable pectate lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000303	0.998955	0.000202	0.000191	0.000174	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004698_02318.