CAZyme Information: MGYG000004698_00670

Basic Information

• Species: Prevotella sp000436695
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000436695
• CAZyme ID: MGYG000004698_00670
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000004698_12|CGC1	36443.45	7.8571

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004698	3424026	MAG	Denmark	Europe

• Gene Location: Start: 49369; End: 50346 Strand: +

Full Sequence      

MKKLILSAVMAICAIAANAANPYDNPDTLVVSRDGTGQFRTINEAVEVCRAFMEYHKVIY
VKNGVYKEKVIIPSWLTNIEVCGESAEKTIITYDDHANIRLAETNKPMGTFRTYTVKVEG
NYITFKNITIENNAAKLGQAVALHTEGDHLLFINCRLLGNQDTVYTGVADTRIYFKNCYI
EGTTDFIFGPSTAWFEGCTIHSKQNSFITAASTPANVAYGYVFNHCKLTAAEGVTKVYLG
RPWRPYAYTVFMNCELGSHILPVGWNNWSNKDNEKTARYMEYNNSGAGAATKERAPWSKQ
LTKKEAAKITLENVFRTDNSWIPEI

Enzyme Prediction     

No EC number prediction in MGYG000004698_00670.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	29	315	9e-103	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	3.11e-79	30	310	3	290	Pectinesterase.
PLN02773	PLN02773	1.85e-78	29	308	7	289	pectinesterase
PLN02682	PLN02682	7.92e-68	28	306	70	352	pectinesterase family protein
PLN02197	PLN02197	9.54e-65	28	324	276	579	pectinesterase
PLN02432	PLN02432	7.83e-63	29	307	13	278	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ81978.1	4.26e-175	1	323	1	322
ADE82952.1	4.26e-175	1	323	1	322
BCS84477.1	1.11e-173	1	325	1	325
QJR97878.1	5.81e-165	14	324	7	319
AGB28242.1	5.14e-160	4	323	6	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	1.79e-45	29	322	9	308	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	8.11e-42	30	297	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	4.26e-40	29	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.31e-39	29	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	3.83e-30	32	325	12	341	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.60e-57	31	306	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	2.19e-56	28	324	272	575	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q5MFV6	4.70e-55	28	324	276	579	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q42608	3.63e-54	28	324	259	562	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
Q5MFV8	1.50e-51	28	324	283	586	Pectinesterase 5 OS=Arabidopsis thaliana OX=3702 GN=PME5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000223	0.999109	0.000183	0.000158	0.000149	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004698_00670.