CAZyme Information: MGYG000004697_01487

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_F
• CAZyme ID: MGYG000004697_01487
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase Y

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	MGYG000004697_19|CGC1	44599.13	4.5095

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004697	2635939	MAG	Spain	Europe

• Gene Location: Start: 47715; End: 48902 Strand: -

Full Sequence      

MKLRKWSMGVCAALGLALCLTGCGQSEQKETKNQTTTAAVTAAAVTDSKSEAKTLKEAFD
GDFKVGVATTSGYLSEEDRVAQIKENFNSITMENEMKPESLLDWEGSEKSKDGMPAIKEE
TLEKALKAAQEAGIPLRGHTLVWYSQTPEWFFSKKYDPSKGYVDKATMKKRMESYIKQVL
TYCKENYPGVVYAWDVVNEAVGDDGNYRTESMWYETYGDFSYIADAFTFARKYAEEGTEL
FLNDYNEYMAQKRDLLYAKVVELHDAGILDGVGMQSHWDMDFPSVDLFETALEKYASIDG
IEIQLTEIDMHNNDDSEEGLKKQADRYKEFFDVITKMKREGKANITSVTFWGLKDGESWL
SGMKGETSYPLLFTDDMEKKPCYESILEAGKTGGK

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	55	389	5.5e-94	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	7.99e-102	55	388	1	310	Glycosyl hydrolase family 10.
smart00633	Glyco_10	3.15e-91	96	386	1	263	Glycosyl hydrolase family 10.
COG3693	XynA	4.10e-70	65	388	36	339	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA43712.1	4.53e-86	55	389	3	337
ADL33823.1	8.84e-85	55	389	3	337
BCS82260.1	5.21e-82	43	390	58	417
CUH92237.1	5.05e-81	44	387	252	600
AZT91389.1	2.29e-80	43	390	58	417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W5F_A	3.15e-67	55	386	184	524	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2W5F_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]
5OFJ_A	6.36e-67	55	389	11	338	Crystalstructure of N-terminal domain of bifunctional CbXyn10C [Caldicellulosiruptor bescii DSM 6725]
6D5C_A	8.70e-67	55	389	23	350	Structureof Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5C_B Structure of Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5C_C Structure of Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii]
5OFK_A	4.98e-66	55	389	11	338	Crystalstructure of CbXyn10C variant E140Q/E248Q complexed with xyloheptaose [Caldicellulosiruptor bescii DSM 6725],5OFL_A Crystal structure of CbXyn10C variant E140Q/E248Q complexed with cellohexaose [Caldicellulosiruptor bescii DSM 6725]
2WYS_A	2.68e-64	55	386	184	524	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WYS_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WZE_A Chain A, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WZE_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26223	9.07e-87	55	389	3	337	Endo-1,4-beta-xylanase B OS=Butyrivibrio fibrisolvens OX=831 GN=xynB PE=3 SV=1
P23557	9.42e-75	96	390	1	302	Putative endo-1,4-beta-xylanase OS=Caldicellulosiruptor saccharolyticus OX=44001 PE=3 SV=1
P29126	3.88e-65	47	391	622	954	Bifunctional endo-1,4-beta-xylanase XylA OS=Ruminococcus flavefaciens OX=1265 GN=xynA PE=3 SV=1
P51584	2.12e-64	55	386	195	535	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1
P10474	6.98e-62	55	389	45	372	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000062	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004697_01487.