CAZyme Information: MGYG000004688_01705

Basic Information

• Species: CAG-873 sp900550395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900550395
• CAZyme ID: MGYG000004688_01705
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
855	MGYG000004688_29|CGC1	96459.69	5.3354

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004688	2658373	MAG	Spain	Europe

• Gene Location: Start: 10586; End: 13153 Strand: -

Full Sequence      

MKYSPRLIATAVLACALGTAAAIDHPGITHDSITPQRFVLLENGEPTPIYVDAAENSAVR
IAAGNLAADFGRVGGQDAAMLSRPDASRMVVAGTWDGPTLKALARDKNLNLRELKGKNEQ
YVITTVSNPWPGVEEALVVAGSDRRGAVYGIYELSEQLGVSPWYDWADAPVRHRVSAAID
RGRYTAGEPAVRYRGIFLNDEAPCLTGWVKNTYGTDYGDHRFYARVFELILRLRGNFMWP
AMWAWAFYADDPANSRTADEMGVIMGTSHHEPMARNHQEWARHRKEYGKWNYAENQEVID
RFFREGIERAKDTEDVVTIGMRGDGDEAMSEDADVALLRKVIDNQRKIIAKTTGRKASET
PQVWALYKEVQDYYDKGLRAPDDVIMLVCDDNWGNVRRLPNAEERRHPGGWGMYYHVDYV
GAPRNSKWLNMTPIQGMWEQLRLTYDYGVDRLWVLNVGDLKPMEYPISLFLDMAWNPERY
EADNFMDHTRGFFSGIFGEQQGPEAARIYNLYCKYAGRVTAEMLDASTYNLADGEWKSVA
DDWTRLEAEAMRQYLTLPDGARDAYFELVLFPVQAMANLYDMYYSQAMNLALYEAGDPRA
NDWADRCEKAFRRDAELMDVYNNTLAGGKWRGMMTQKHIGYTSWNDAFPADTLPELKRIQ
NTVRDCGGYVTTVRDGVAVIEAEHFNSAVAAPGLKWTVIPDMGRTLSGVALRPYTEPVGD
SRLSYRIDNHGAQPDSVTVHVVVKSTLDFLNAGGHCYTVGLDGTEPVTVNFNADMLDTPQ
YQYTVFYPTVARRVVEKTVRLPLDKSVGEHTLMLRPLAPGIVFEKVVVDFGGYRPGYLFG
RESSYRRDNVTAQTK

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	37	826	8.5e-270	0.9956958393113343

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	187	523	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	2.10e-41	675	838	6	168	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	1.55e-06	37	154	4	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD34650.1	0.0	1	849	1	848
QUR44901.1	0.0	37	849	32	844
ADD61499.1	0.0	20	848	19	859
ABR37760.1	0.0	22	853	21	864
QQY39902.1	0.0	22	853	21	864

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	0.0	37	849	43	855	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	0.0	24	850	3	841	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	0.0	24	847	2	837	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	2.03e-171	49	653	25	627	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	5.84e-120	76	646	55	647	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000654	0.923453	0.075000	0.000341	0.000279	0.000241

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004688_01705.