CAZyme Information: MGYG000004688_01233

Basic Information

• Species: CAG-873 sp900550395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900550395
• CAZyme ID: MGYG000004688_01233
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517		55926.08	4.8512

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004688	2658373	MAG	Spain	Europe

• Gene Location: Start: 161; End: 1714 Strand: -

Full Sequence      

MFKRFKLAAAALLAAGSLWACSDDEPTPDPIPDKPATENHISVESVSPDIVAAEGGEVTV
TVKSGRVPTGKADADWVTRVSSSREGEIATFVFAVKANEGSEERSSVITFKAGDLTADAT
IRQAAGEIKPAPIPDLTDVDSSVDFARVLALGWNLGNQFDAHNNGTASETAWGNPAATQE
LFNKLAEAGIRSVRIPVTWLGQFGAAPDYTINAAWLDRIAEIVGYAENAGLRAVINIHHD
GADSAHWLNIKDAAKDAALNTSIKEQIKALWTQIAQRFADKGQFLMFESFNEIHDGGWGW
GENRKDGGKQYAVLNEWNQVFVDAVRATGGNNATRFLGVPGYVTNPDLTLEHFVKPTDSA
NDRLLVAVHYYDPNDFTLTAKFTEWGHTGDASKKASYGDEGDLRNMFGRLADKYVKAGTG
LYIGEFGCTTRANSRDELFRLYYLEYVCKAGHDNGFGMFIWDNGSTGTGNEANGYFNHGS
GAFISNKAKAAVETMVKAFTNTDASYTLDAVYQGAPK

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	168	464	6.8e-90	0.9927536231884058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	5.11e-47	157	465	4	270	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	3.80e-25	133	487	35	389	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd14948	BACON	2.11e-14	45	124	3	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam13004	BACON	7.20e-06	73	124	8	61	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT88430.1	1.46e-185	36	517	122	598
AVM57519.1	7.33e-185	11	517	59	563
ALJ60576.1	1.38e-182	44	517	29	512
QUT35080.1	9.99e-179	11	517	13	517
QRX62664.1	1.75e-178	33	517	29	513

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WQY_A	1.72e-160	140	495	22	378	ChainA, Cellulase [Phocaeicola salanitronis DSM 18170]
4YHE_A	8.18e-134	140	517	5	386	NativeBacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a],4YHE_B Native Bacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a]
4YHG_A	6.58e-133	140	517	5	386	NativeBacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a],4YHG_B Native Bacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a]
2JEP_A	8.09e-78	141	467	31	367	Nativefamily 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEP_B Native family 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEQ_A Family 5 xyloglucanase from Paenibacillus pabuli in complex with ligand [Paenibacillus pabuli]
6MQ4_A	2.20e-55	141	471	11	323	ChainA, cellulase [Acetivibrio cellulolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O08342	2.13e-71	109	467	4	372	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
Q12647	2.84e-55	141	464	24	331	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1
P28621	3.90e-52	141	477	41	355	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P28623	1.83e-51	149	477	50	353	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
A7LXT7	2.75e-51	81	466	82	477	Xyloglucan-specific endo-beta-1,4-glucanase BoGH5A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02653 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000061	0.999952	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004688_01233.