CAZyme Information: MGYG000004678_00126

Basic Information

• Species: Finegoldia magna
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Finegoldia; Finegoldia magna
• CAZyme ID: MGYG000004678_00126
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	MGYG000004678_3|CGC1	36510.61	9.1742

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004678	1841606	Isolate	United States	North America

• Gene Location: Start: 569; End: 1525 Strand: -

Full Sequence      

MKIVGVDVSKYNGYPDWEKAKQSGVQFAILRLGSGYNGGYVDKTFEYNYRECKKAGIGVG
VYVASYLNISSEIDMTLKALKGKQLEYPVYFDIEDFSLGGRSYTNTQLTNYAVRYCSEVE
RAGYYVGIYSNKAFLDSRLYWERIKKYDIWIAHWNKGVNYAGKYGMHQYTNKGQWRGIPS
TGEGGVDTNWCFVDYPGLMKKLELNGYKKPKEEVKGLTKMEEEKLLDEIKQTVVTYEDRD
YDKAVKIAKQHRAVLVPAELNMDFGKMKRSKDTIIGIGDKTGKIEGENFGITGYCDYLVS
ADKVDEFLKDRSKFLRRK

Enzyme Prediction     

No EC number prediction in MGYG000004678_00126.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	6	178	4.5e-39	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	3.62e-68	3	192	1	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	1.81e-37	5	190	2	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06525	GH25_Lyc-like	6.97e-27	5	182	2	179	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
pfam01183	Glyco_hydro_25	1.66e-22	6	178	1	180	Glycosyl hydrolases family 25.
COG3757	Acm	1.10e-16	1	189	61	251	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKH79742.1	1.35e-214	2	318	3	319
BAG07790.1	7.65e-44	5	207	576	780
QKH79509.1	3.39e-42	5	207	581	785
QKN24292.1	8.13e-42	1	282	1	285
ARP50082.1	8.13e-42	1	282	1	285

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JFX_A	6.11e-06	3	154	5	165	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004678_00126.