CAZyme Information: MGYG000004676_00169

Basic Information

• Species: Bacteroides sp900766005
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900766005
• CAZyme ID: MGYG000004676_00169
• CAZy Family: GH9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
842	MGYG000004676_2|CGC1	95468.21	7.1315

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004676	1765238	MAG	China	Asia

• Gene Location: Start: 17408; End: 19936 Strand: -

Full Sequence      

MKNSFIKKSVCALGACCFCVGMAHADEWIRINQLGYLPQSVKVAVFMSDEATSVQEYALV
DAFTKQTVKTFRAPQSTGAWENMKSTYRLDFSDFVQPGTYYLKAGNAVSPTFPIAADVYK
GTADFLLNYLRQQRCGDNPRFDKKCHQKDAYIVYHPTKNGQHIDVRGGWHDASDYLQYTT
TTANAIYQMMFAYQQNPEAFGDEYGTDGRKGANGIPDIIDEIRWGMDWLNRMNPEPGEFY
NQLADDRDHVSMRLPFLDPADYGYGPGNGRPVYFCSGEKQKRGKFMNETTGVASTTGKFA
SCFSLGSRILKDFYPELAEQIGKKAKDAFDMGVKKPGVCQTASIVSPYIYEEDNWTDDME
LAAMELYHASGEKEYLNRAVEYARREPVTPWMGADSARHYQWYPFVNLGHYHLAKVKGNS
RLNQEFVRNLRAGIERTFEKAVKSPFLHGIPYIWCSNNLTVAMLTQCGLYRELTGDRKYA
EMEAAMLDWLLGCNPWGTSMIIELPLHGDYPSESHAALLLHKGYGQPTGGLVDGPVYNSI
FKGLRGVNLNGLPGLPGEKYEAVQPRTMVYHDVVNDYSTNEPTMDGTASLTYYLSLMEVE
GMKQGQLSKDLNRYVDGGIVGTNPGKKVISLVFTSDDKVDGEEKIIRVLDKNKVKGSFFF
TGNFFRRYPEVVKRLLEKQHYVGSHSDKHLLYMPWENRDSLLVSRAEFENDLLNSYREMS
KLGINYQDAPLFMPPYEYYNRTIAAWTKGLGLRVVNYTPGTLSNADYTTPDMGKSYRSSK
EIFEHLLAMEKKEGLNGAILLVHFGTDPKRTDKFYDTYLNKLIQTLKRKGYQFQTISEAV
AK

Enzyme Prediction     

No EC number prediction in MGYG000004676_00169.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH9	119	594	1.4e-77	0.992822966507177
CE4	631	756	3.5e-16	0.8846153846153846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00759	Glyco_hydro_9	6.32e-62	127	594	7	374	Glycosyl hydrolase family 9.
cd10917	CE4_NodB_like_6s_7s	4.27e-30	627	827	1	171	Catalytic NodB homology domain of rhizobial NodB-like proteins. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes many rhizobial NodB chitooligosaccharide N-deacetylase (EC 3.5.1.-)-like proteins, mainly from bacteria and eukaryotes, such as chitin deacetylases (EC 3.5.1.41), bacterial peptidoglycan N-acetylglucosamine deacetylases (EC 3.5.1.-), and acetylxylan esterases (EC 3.1.1.72), which catalyze the N- or O-deacetylation of substrates such as acetylated chitin, peptidoglycan, and acetylated xylan. All members of this family contain a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold with 6- or 7 strands. Their catalytic activity is dependent on the presence of a divalent cation, preferably cobalt or zinc, and they employ a conserved His-His-Asp zinc-binding triad closely associated with the conserved catalytic base (aspartic acid) and acid (histidine) to carry out acid/base catalysis. Several family members show diversity both in metal ion specificities and in the residues that coordinate the metal.
cd02850	E_set_Cellulase_N	6.60e-28	28	114	1	86	N-terminal Early set domain associated with the catalytic domain of cellulase. E or "early" set domains are associated with the catalytic domain of cellulases at the N-terminal end. Cellulases are O-glycosyl hydrolases (GHs) that hydrolyze beta 1-4 glucosidic bonds in cellulose. They are usually categorized into either exoglucanases, which sequentially release terminal sugar units from the cellulose chain, or endoglucanases, which also attack the chain internally. The N-terminal domain of cellulase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam02927	CelD_N	4.60e-27	28	109	2	83	Cellulase N-terminal ig-like domain.
cd10949	CE4_BsPdaB_like	2.17e-21	626	842	3	192	Putative catalytic NodB homology domain of Bacillus subtilis putative polysaccharide deacetylase PdaB, and its bacterial homologs. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. This family is represented by the putative polysaccharide deacetylase PdaB encoded by the pdaB gene on sporulation of Bacillus subtilis. Although its biochemical properties remain to be determined, the PdaB (YbaN) protein is essential for maintaining spores after the late stage of sporulation and is highly conserved in spore-forming bacteria. The glycans of the spore cortex may be candidate PdaB substrates. Based on sequence similarity, the family members are classified as carbohydrate esterase 4 (CE4) superfamily members. However, the classical His-His-Asp zinc-binding motif of CE4 esterases is missing in this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT35459.1	0.0	25	840	21	834
QUT66756.1	0.0	25	840	21	834
QPH59586.1	0.0	25	840	21	834
QUT98069.1	0.0	25	840	21	834
QQA29127.1	0.0	25	840	21	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3X17_A	1.59e-39	29	592	18	551	Crystalstructure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium],3X17_B Crystal structure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium]
5U2O_A	1.14e-28	37	595	2	537	Crystalstructure of Zn-binding triple mutant of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
5U0H_A	4.66e-26	37	595	2	537	Crystalstructure of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
1UT9_A	7.43e-26	29	598	7	605	ChainA, CELLULOSE 1,4-BETA-CELLOBIOSIDASE [Acetivibrio thermocellus]
1RQ5_A	4.08e-25	29	534	7	552	ChainA, Cellobiohydrolase [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14090	2.18e-23	29	601	341	911	Endoglucanase C OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cenC PE=1 SV=2
P0C2S1	2.39e-23	29	598	214	812	Cellulose 1,4-beta-cellobiosidase OS=Acetivibrio thermocellus OX=1515 GN=celK PE=1 SV=1
Q05156	2.48e-23	29	601	185	746	Cellulase 1 OS=Streptomyces reticuli OX=1926 GN=cel1 PE=1 SV=1
A3DCH1	5.47e-23	29	598	214	812	Cellulose 1,4-beta-cellobiosidase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celK PE=3 SV=1
P23658	1.49e-22	29	595	4	543	Cellodextrinase OS=Butyrivibrio fibrisolvens OX=831 GN=ced1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001316	0.860524	0.137274	0.000307	0.000289	0.000262

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004676_00169.