CAZyme Information: MGYG000004667_02262

Basic Information

• Species: Clostridium beijerinckii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium beijerinckii
• CAZyme ID: MGYG000004667_02262
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1543	MGYG000004667_50|CGC1	170894.9	4.3299

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004667	6180974	Isolate	United States	North America

• Gene Location: Start: 62841; End: 67472 Strand: -

Full Sequence      

MNKNSQIFAASFVGTAMVASMFAAPVLAVDATQSQKVNFPSISFEDGEDVADYESYEVDT
SIVSTDATDGSKALKATYKPADWPGIHLLPKSGQVWDLGEGNALSLDIKNESDKAVDLYV
KIYDGSDDADSTIFKGNIKANESNSFYTSLAQGNDSELGMHQNPPSGKGINASYAWGKKD
LNLSNVTRIDIWLMYNKEPVTLVFDNIRSIPDPSSDKSYLNNIIDTYGQYTKETWDGKIT
NDQQLLDNKAAEQLELQAGLETRNNAPLTQYGGWKNEAFKQEATGHFYPKKIHGKWSLVD
PEGYPYIATGLDIIRLDDMLTWVSGRDYMFENIPDRTKFEDSYTDNISGLRPPAGLETGT
GINFYKANLQRKYGDDYLEDWKQTTLDRFKSWGFTSLGCWSDPNMFFGKGEENKISYVAN
GWINGNHQKISSGGSWGAVADPFDPEFKVSAENMAQSVASKGVNEDPWCLGIYVDNEISW
GNSGNPDQYYAIIKETFKLNKENSYAKQAFIQHLKNKYSSIGNLNNAWGTSIASWEVLEQ
SYSGTIGKEDCSEMLSSIADKYYKTVNEAVKKYLPNILYIGSRLAEWGTSIEVEQACAKY
VDVMSFNCYKTDINQDWMNFGAYDKPIIIGEFHFNAMDHGYFAPGLVPVEDQQARADAYE
KYMQSVYKNDNFVGAQWFQYYDQPILGRAWDGENTNAGFVDVADEPYKELVEAAKRSNYS
AYDLKYNRVSISSISLNQNNVILNDTKREFQLNAAISPSNADNTELTWKSSNPTVATVDE
TGKVSAVDNGTTIITVTSKANPAMKATCEVIVTGLKNNDEITFPKLSFEGDDVVSHSIGG
HKDANTEVVSTSATDGNYALEVTGNSYDQWGNFGSIDFTCPDGTWNIGKGNPLKMDITNP
NDTPIQVRSNVMDENNHTRTYYFTIPANSTRTIEIKDFAAGPDSWGDDGYFGAADTGIDS
TKIKFISAFAWADPNSNPETPLKFIIDNIKSGGNLDSSEKMTFPKVSFEDDEDILYKLEG
LKQGTLDTIADKGVTDGSSALKLTIDSLNTEDNGNVTRVDFAKDSGTWSLGKDGVLKFDL
TNSNNYKIQARVNITDENSVTRTYYYSINPNDTRNIEINNFDKSSDIWETDGLFGAPNGI
DKTKIKSISMYVWEADPGLSNPCTIIIDNLRAEKADTSGQEDLFTKAYFKNIDNWEDLKA
YIRTVDKNGNLIEELEAWPGVPLKSEGDDLYSYELPKGFKDSSITFIGYVTTSAGATIID
EGNMNSNTTTGAGASVIVDGKEEKTTRTVKITNGNVMIYSNGIWGKYGDDTDDNNDSGSG
SDSGSGSNSGSGSSSGSGSNSNSSSSSNQNNEDIINGWGTGNDNKGIYYVNGKPAAGFTK
IGDDYYFFNNEGKMQTNWFMDSNNNWYKFTNEGKMIKDWYKDDDGKWYHFNQSGQMSKGW
VQSPNSGKWYFLDDTGAMATGWIKSPNSGKWYFLDNTGAMATGWIQSSNSGKWYYLDDTG
AMITGWVKSPSSGKWYYLDDTGAMVTNTIIDGYKIDSDGVWVR

Enzyme Prediction     

No EC number prediction in MGYG000004667_02262.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	92	722	7.6e-178	0.9800918836140888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	9.16e-44	1363	1542	468	660	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	5.41e-42	1357	1542	487	683	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033840	PspC_relate_1	1.35e-34	1396	1543	510	648	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.
NF033838	PspC_subgroup_1	1.42e-33	1417	1526	485	586	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033930	pneumo_PspA	1.98e-32	1417	1526	442	543	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUI25447.1	2.36e-244	37	726	36	736
QTH40851.1	5.75e-216	22	990	171	1059
QGG56465.1	6.15e-215	22	990	171	1059
QGG56387.1	1.56e-208	16	989	12	887
AKV62624.1	6.48e-207	10	989	6	887

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BQ2_A	5.78e-141	71	722	37	743	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	1.55e-140	71	722	37	743	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
6XJ9_A	8.05e-134	96	728	81	765	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]
5Z6P_A	6.80e-128	74	726	67	763	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]
5T3B_A	3.15e-14	268	724	83	475	ChainA, Glycoside Hydrolase [Phocaeicola plebeius],5T3B_B Chain B, Glycoside Hydrolase [Phocaeicola plebeius]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	6.59e-146	91	728	285	955	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	8.30e-100	45	722	211	913	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000267	0.999010	0.000181	0.000201	0.000170	0.000150

TMHMM  Annotations     

start	end
7	29