CAZyme Information: MGYG000004660_01260

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000004660_01260
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
539		60928.66	5.6875

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004660	1964208	MAG	China	Asia

• Gene Location: Start: 3421; End: 5040 Strand: -

Full Sequence      

MVKEQERIAAANLFTTPKGEVVIDFGQNITGYVEISLKAHSGDTVSLSHAEVMDSEGNFY
TENYRGAKALYHYTCQDGWQTYKPHLTFFGFRYIRVNQFPGGIQNASLENFTAIAVHSDM
KRTGWLSCSDPLLNRLFDNIIWGQKGNFLDVPTDCPQRDERLGWTGDAQVFVRTACLNYD
AETFFTKWLADMAIDQKENGCIGAVIPDLLQNTTVSAAWGDAATICPWEVYLAYGNPKIL
QQQFVCMKKWVDFITHTTTTPYLWTGGEHYGDWLGLDAPSGSYKGSSREDFIASAFYAHS
TSLLIKAGTVLQKDMSSYKELYKNIVTTFQKTYPRYETQTECILAAHFHLAPDCQAAADQ
LAQMILSCGTKLQTGFVGTPYLLHVLSQYGYSELAYSLLLRRQYPSWLYPVTKGATTIWE
HWDGIMENGDFWSSDMNSYNHYAYGSVADWVYGVAAGITPLEEAPGYAKVRIAPTPDIRL
DWLTARLDTRHGEIVSKWKQHDTVWRYEITTPVDAEIIIDGVSHTVKPGTYYYYSPIRS

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	14	517	9.5e-156	0.9880952380952381

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	8.71e-124	121	452	1	337	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	2.06e-26	15	117	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.43e-09	457	513	1	55	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE96651.1	3.27e-298	2	539	200	737
QMW80109.1	9.46e-296	2	539	200	737
QIB57111.1	9.46e-296	2	539	200	737
QJU17505.1	2.75e-292	2	539	200	737
ANU76871.1	1.58e-291	2	539	200	737

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	6.57e-113	11	525	488	1005	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.19e-106	11	498	318	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	2.99e-83	2	516	345	893	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	2.83e-112	11	525	488	1005	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	4.31e-110	22	512	372	869	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	4.70e-98	2	518	349	877	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	2.79e-43	2	516	365	901	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004660_01260.