CAZyme Information: MGYG000004658_03015

Basic Information

• Species: Alistipes finegoldii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes finegoldii
• CAZyme ID: MGYG000004658_03015
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	MGYG000004658_144|CGC2	40715.67	4.7747

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004658	3509081	Isolate	United States	North America

• Gene Location: Start: 39627; End: 40718 Strand: -

Full Sequence      

MNKLIKLGCIALAGTLLFSCETDPEKLEIVKPYPKSDQYYADLRDYKNSDHEIVFGWFGN
WSATGASASNYMKSLPDSIDMVGLWGGWQTITEAQRKDMEDSQHKRGLKVIATSLFDGFE
MGVAPDGATAATEEEMLAYWGWEGPYRSYGNDNLTEGNIAAIQRFAHAFCQRIIDNGYDG
LDIDNEPNIGTGKKPYGISGFPNRYKVFMDVVVTYFGRTSGTGRILAIDGELNANMPREF
GKCFDYFISQAYGCSGDSNLDGRLQSCANYFSEVPFKDVARRFIVTENFENITYRTNGGA
NYTTRDGESMKSVAGMAQWQPIIDGEKVMKGGCGTYHMEYEYRNPEPYKFLIEAIQIQNP
ARK

Enzyme Prediction     

No EC number prediction in MGYG000004658_03015.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16141	DUF4849	1.73e-58	22	357	1	318	Putative glycoside hydrolase Family 18, chitinase_18. This DUF is likely to be a form of glycosyl hydrolase from CAZy family 18, possibly chitinase 18. This would have the EC number of EC:3.2.1.14.
cd06542	GH18_EndoS-like	2.20e-39	53	346	2	246	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFL76480.1	1.97e-284	1	363	1	363
AVM53068.1	4.35e-88	1	361	1	350
AVM57674.1	3.94e-86	1	361	1	350
QQY39391.1	1.58e-85	33	363	35	351
ABR38325.1	1.58e-85	33	363	35	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q64_A	4.04e-43	3	359	2	356	BT1044SeMetE190Q [Bacteroides thetaiotaomicron]
6KPL_A	2.92e-13	43	339	21	269	CrystalStructure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in apo form [Cordyceps militaris CM01],6KPM_A Crystal Structure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in complex with L-fucose [Cordyceps militaris CM01]
6KPN_A	3.19e-12	43	339	21	269	CrystalStructure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris D154N/E156Q mutant in complex with fucosyl-N-acetylglucosamine [Cordyceps militaris CM01],6KPO_A Crystal Structure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris D154N/E156Q mutant in complex with fucosyl-N-acetylglucosamine-Asn [Cordyceps militaris CM01]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36912	2.78e-12	9	360	11	335	Endo-beta-N-acetylglucosaminidase F2 OS=Elizabethkingia meningoseptica OX=238 GN=endOF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000069	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004658_03015.