CAZyme Information: MGYG000004658_00295

Basic Information

• Species: Alistipes finegoldii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes finegoldii
• CAZyme ID: MGYG000004658_00295
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	MGYG000004658_33|CGC2	38271.94	9.0848

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004658	3509081	Isolate	United States	North America

• Gene Location: Start: 61766; End: 62773 Strand: -

Full Sequence      

MNFSKNAILLAGILLTAFGSLRAQVRQTREEYIDRYKSIAVAHMERYGIPASITMAQGIL
ESDCGNSRLSLMSNNHFGIKCKRNWTGEKVYHDDDANGECFRSYSTVEASYQDHAEFLDS
QPRYDSLFAYSPTDYKSWARGLKAAGYATAPDYAQRLCRIIEEAQLFLLDQPDGERLYAS
RSGRKITDPEGWFTDQTSMERTADTSPAVDPDNYRVTINAHNGYNVYATNGVHYMLAKEG
DTFENIGKKFRISARNLRKFNDLKDKKAQPMPHEVVYIERKKKRWEGNAHTHTCRQGETA
YAVGQSYAIRTRSIEKLNKLRPGDTLEQGRQIRIK

Enzyme Prediction     

No EC number prediction in MGYG000004658_00295.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	39	166	4e-35	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	8.06e-32	3	180	7	198	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	5.56e-30	26	170	157	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	8.74e-25	37	114	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	1.87e-22	24	162	3	137	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK05684	flgJ	6.16e-20	29	161	152	294	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFL77234.1	4.38e-242	1	335	1	335
BBL09489.1	1.38e-213	1	335	1	335
BBL12282.1	1.38e-213	1	335	1	335
BBL01630.1	1.38e-213	1	335	1	335
CBK64601.1	4.88e-193	1	335	1	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	2.93e-15	30	161	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	3.57e-15	30	161	3	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	2.40e-14	30	161	3	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN5_A	3.91e-09	30	163	4	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	5.06e-09	30	163	4	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9X9J3	2.17e-15	30	165	161	306	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
O32083	1.03e-14	29	171	48	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9KQ15	7.93e-14	28	183	160	317	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9I4P4	1.01e-10	30	167	240	388	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
P37710	4.76e-08	27	335	178	473	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002622	0.767396	0.228837	0.000476	0.000364	0.000275

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004658_00295.