CAZyme Information: MGYG000004650_00889

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter
• CAZyme ID: MGYG000004650_00889
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000004650_32|CGC1	43247.3	9.3651

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004650	2976949	MAG	China	Asia

• Gene Location: Start: 19017; End: 20141 Strand: -

Full Sequence      

MKYYMIVGEASGDLHASNLIKGLKQEDPEAQVRGWGGDLMREAGAEIVRHYKDTAIMGFI
NVVRKLGTLRDNIRYCCEDIRTWQPDVVILVDYAGFNLRIARFAKGIGLKVFYYISPKLW
AWNTGRVKQIKKYVDRMYTIFPFETDFYRRYNYPVYYGGNPLVDAIDSRPCKEETFSEFI
RVNGLPDKPIIALLAGSRKQELKFVLPTMLKMIEHFPEYQFVIAGAPSMTDEDYAPYLQG
RQIRILYGMTYRLVSQATAALVTSGTATLETALLRTPQVVCYNGEAARLSYFLFKTVVKV
KFISLVNLIFDGEVVKELMMQHFNERTLVEELSRIVYSERYREKMLRNYDEVIRRMGEPG
ASGRFARMMVEALR

Enzyme Prediction     

No EC number prediction in MGYG000004650_00889.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	354	1.2e-113	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	6.48e-111	1	374	2	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.82e-97	1	374	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.81e-76	4	318	2	321	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.48e-65	5	371	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.07e-46	52	369	46	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY31424.1	2.85e-215	1	370	1	370
SNV26174.1	2.85e-215	1	370	1	370
AZS31618.1	1.82e-183	1	373	1	373
QRO51639.1	1.41e-180	1	373	1	373
BAX81022.1	3.71e-139	1	373	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.18e-33	5	328	11	337	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.27e-33	5	328	11	337	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	5.60e-64	5	373	11	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
A9KC41	6.36e-64	5	346	8	347	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
B6J161	6.36e-64	5	346	8	347	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
Q83DS5	1.26e-63	5	346	8	347	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
A9NCA7	1.26e-63	5	346	8	347	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000022	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004650_00889.