CAZyme Information: MGYG000004648_00717

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495
• CAZyme ID: MGYG000004648_00717
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394		44364.22	9.9388

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004648	1121775	MAG	Spain	Europe

• Gene Location: Start: 290; End: 1474 Strand: +

Full Sequence      

MKTSENLIIYLIAGEPSGDLRGSRLMRALREKTKGKVEFYGLGGDTMEAAGLKSIFDISD
LAIMGLVEVIPSIPKVLRHIKNTVQDIERVKPDIVITIDSWSFCARVHKALRKLKLGIPQ
LHYVAPQVWAWKKKRARTMYKYIDALMTLLPQEPKYFTPYHLETVFVGHPVIESEVLHAD
GQAFRERFNIPKEKRIIAILPGSRKTEVSKLLPVFLESGRKLLEKDKDFYFVIPTVRTVS
KLVKAGVKDCGLPLIVVETQEDRYNAFQASSAAIAASGTVALELAICHIPHIIAYKVSKL
TAWIVAKIMKIQFVNLTNIMLGRLVVPELLQEQCVSGNITNKILELLAKGDLYEREQEGF
RKVKETLSAGEQTPSENAADFILELISRKSEKKK

Enzyme Prediction     

No EC number prediction in MGYG000004648_00717.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	9	367	5.6e-119	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	6.72e-131	6	390	1	379	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.40e-129	9	388	4	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.35e-94	9	379	1	371	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.61e-76	9	385	8	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.34e-44	13	333	8	303	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10250.1	4.20e-180	4	389	2	387
AMW35095.1	1.23e-108	3	384	2	383
ARJ65449.1	1.91e-108	7	391	6	391
CUW40282.1	2.71e-108	6	391	5	391
BAE51288.1	6.55e-108	7	393	1	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	6.07e-57	1	385	1	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	8.53e-57	1	385	1	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2W4D7	1.31e-108	7	393	1	388	Lipid-A-disaccharide synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=lpxB PE=3 SV=1
B6IST7	5.64e-102	7	389	4	386	Lipid-A-disaccharide synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=lpxB PE=3 SV=1
Q5FUA3	2.04e-85	8	387	30	406	Lipid-A-disaccharide synthase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=lpxB PE=3 SV=1
Q0BS63	7.41e-80	8	347	5	341	Lipid-A-disaccharide synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) OX=391165 GN=lpxB PE=3 SV=1
Q2IW93	1.83e-77	9	388	14	392	Lipid-A-disaccharide synthase OS=Rhodopseudomonas palustris (strain HaA2) OX=316058 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004648_00717.