CAZyme Information: MGYG000004645_01692

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; QALW01; UMGS1322
• CAZyme ID: MGYG000004645_01692
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
173		19629.68	5.4022

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004645	2112164	MAG	China	Asia

• Gene Location: Start: 15; End: 536 Strand: +

Full Sequence      

MVGRLSNEKRQDVLIRAVAQSKYRQKIKLVLAGKGPRKEALIRLARKCGVDMKTDFFLKP
DLLDLIAMSDLYVHAADMEIEAMSCMEAFAGGLVPVIADSKKSATPQFALDERSLFEAGS
SEALAQRIDYWMEHEQERKEMEYIYSGLATQYNLDRCVLQAEEMFAEAIRERG

Enzyme Prediction     

No EC number prediction in MGYG000004645_01692.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	1	142	5.6e-21	0.90625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03817	GT4_UGDG-like	8.17e-31	1	152	206	355	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
pfam00534	Glycos_transf_1	4.23e-24	1	141	7	151	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
COG0438	RfaB	1.68e-19	1	172	204	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	4.56e-19	1	165	197	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03820	GT4_AmsD-like	9.21e-16	1	156	186	339	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW80512.1	2.17e-69	1	171	207	379
QIB56714.1	2.17e-69	1	171	207	379
QCI58773.1	7.22e-57	1	172	203	374
QUO37404.1	9.70e-57	1	172	203	374
QCT71572.1	1.08e-55	1	173	203	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QHP_A	4.11e-46	1	160	7	166	Crystalstructure of the catalytic domain of cholesterol-alpha-glucosyltransferase from Helicobacter pylori [Helicobacter pylori 26695],3QHP_B Crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from Helicobacter pylori [Helicobacter pylori 26695]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004645_01692.