CAZyme Information: MGYG000004633_01513

Basic Information

• Species: Erysipelatoclostridium sp002160495
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Erysipelatoclostridium; Erysipelatoclostridium sp002160495
• CAZyme ID: MGYG000004633_01513
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470	MGYG000004633_55|CGC1	55206.35	5.036

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004633	2814686	MAG	Germany	Europe

• Gene Location: Start: 6648; End: 8060 Strand: +

Full Sequence      

MERKLPDNFYWGGSVSSFQTEGARNEGGKGVCVYDVRPMNPEFSDWSVAIDEYHRYDEDI
ALMKDMGFNFYRFSICWSRIIPNGTLDEPVNEEGVKFYNELIDKLLAAGIEPMITLVHFD
MPYHLVKEYNGFASRYVVDCFERYAKVCIERFGDRVKHWMSFNEQNLHAMMLRVSNAEEI
PEGVDPAKHLYQVNHNVFIAHCKAVRALRNMQPDAKFCGMSAVTNIYPYSNTPKNNLFAW
QAYQYMNGFHTDVFSKGKYPDYMVAYLTNRGWMPKFEEEDEELLKYTVDYIAFSYYRSNT
ITEGEFDYKRPYHEVVGEHVVKNPHCEANEWGWEIDPQGLRWTMNDLYNRSGLPVFILEN
GIGWREDMTQEEVDAMLAAGKTIEDDYRINYHRDHIKEMKNAIFEEGVECLGYITWGPID
ILASMCNMDKRYGFVYVNRTNKDLRDLKRIPKKSYQWVKKAFESNGEDLD

Enzyme Prediction     

No EC number prediction in MGYG000004633_01513.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	1	466	2.6e-144	0.9953379953379954

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	1.33e-175	2	470	1	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	1.09e-142	5	467	5	453	Glycosyl hydrolase family 1.
PRK09589	celA	4.24e-140	4	469	3	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	1.76e-135	6	470	5	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	2.33e-122	5	470	6	478	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPS12285.1	0.0	1	470	1	470
QMW74444.1	0.0	1	470	1	470
QQV07247.1	0.0	1	470	1	470
QQY28928.1	0.0	1	470	1	470
QUN14519.1	0.0	5	470	1	466

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	3.44e-130	3	469	6	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	3.80e-117	5	469	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
4F66_A	4.33e-117	4	469	6	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.22e-116	4	469	6	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
7M1R_A	4.88e-116	3	469	9	480	ChainA, 6-phospho-beta-galactosidase [Bacillus licheniformis],7M1R_B Chain B, 6-phospho-beta-galactosidase [Bacillus licheniformis],7M1R_C Chain C, 6-phospho-beta-galactosidase [Bacillus licheniformis],7M1R_D Chain D, 6-phospho-beta-galactosidase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	4.29e-128	2	469	5	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	1.09e-112	5	470	7	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P26206	6.80e-112	1	469	1	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
P11988	1.12e-111	3	469	2	462	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2
Q46829	5.89e-111	5	469	8	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004633_01513.