CAZyme Information: MGYG000004632_00675

Basic Information

• Species: Prevotella sp002300055
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002300055
• CAZyme ID: MGYG000004632_00675
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1208	MGYG000004632_6|CGC2	134009.7	6.1133

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004632	2937832	MAG	Germany	Europe

• Gene Location: Start: 62286; End: 65912 Strand: +

Full Sequence      

MISKTKLLQLVVAFLLIVGMANTKATAQIVENPQGVCDLLNRIGGEGTAKRIVTIVDPTV
GSSIREAFVVTSKDGKPCVKGSNLSALTTGINWYLNHYAHVNLAWNNLTTNLAQRELPVP
TKQEKHSTATSYRYYLNYCTFSYSMSTWTWERWQQEIDWMALHGINMPLQIVGLDVVWKK
LLTQDLGYTDDEANQFIAGPCFQAWWGMNNLEGWGGKNPDWWYKRQEALAKKILAREREL
GMQPVLPGYAGMVPSDIAKKGYSANNQGNWCGFVRPYILDPNTQAFADISEKYYARLAEV
MGTSAYYSMDPFHEGANTSGIDVASAYKRIGEAMFKANSKAKWVIQFWQWSGAQYNVLSQ
VNKGKLIVLDLFSDAHTHFAEYNGHDAVYCMLPNFGGRTGLFGRLSKVMTDFYTQKSSYA
NVKGIGATPEAIEQVPVLYDALFELPWRASTPPLDTWLKDYALARYGVSNEQALKAWKQV
SQTALRCETALQGPHEAVFCARPSLTVDRVSSWGGTSIFYNPQGMIGAAHNLLAANLTGS
NYSYDLTDFARQALTDYGHELLASINEVAASASDAKTYANRRDAYLQLMLDLDRLLSTNP
NFMLGRWTTMARAIADEAEGTTEADRQWLELNNARTLITTWGNETASEAGGLRDYSYREW
AGMLKDFYYPRWKAFFSHRDNGTALPNWFANDWQWAHNASLSYSNQPVGNTREVAAQLLG
KYFATLTKADASPYYIYRHMATDATASIVFTALRGTTFALPLTLADGAKATLAIDMNNDG
SFAPNETVEAPTFDIPAKALCGKMKAMLTLDDGTQLVFTIVVKDNITQPRTVTVQTADAK
QGSVQIVGATGLSVTTDKEVTLRAKAASGCEFLNWTDASGRVVSTDNPYTYYGADPETFT
AHFFADKWGTPAENMADYNDMKSYGQYLRSLTVAQNGGEEKSIYATTDCPEALCQTTQTV
KAPQGSQFRLHWLSAGGLNYCRLSAYIDWNGDGNFDGDNELLQVYGAKDSPGNDALNNYT
LTVTLPYDVPLGITRIRLRFDSSWAPGWDSTTDAMPAKSETKRMVYDIPLLVTDKADEPC
TVTVKTADAKQGTADANGQPDTYTYGAGEEIVLRAYPADGYAVDYWTDTYGRRVPQAWAD
ANFLRFYAPESGTYTVHFKQALPNAIEAVGIDNAPSATVCDLQGRKVNNKRHLHSGVYIV
NRHKQIVK

Enzyme Prediction     

No EC number prediction in MGYG000004632_00675.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	74	719	3e-195	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	6.47e-156	133	449	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	4.92e-73	457	715	1	257	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	9.90e-15	34	118	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12583.1	3.53e-230	26	723	16	718
QQT77518.1	2.23e-189	46	699	35	704
QRP57238.1	2.23e-189	46	699	35	704
ASM65926.1	2.23e-189	46	699	35	704
QDM11879.1	4.88e-189	7	679	1	677

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	7.09e-121	43	717	182	875	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	8.57e-121	43	717	190	883	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	8.70e-120	43	717	205	898	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	7.99e-96	79	723	54	712	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	1.04e-94	79	723	77	735	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	1.95e-82	68	723	80	805	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000207	0.999176	0.000157	0.000165	0.000147	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004632_00675.