CAZyme Information: MGYG000004630_00563

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerosacchariphilus
• CAZyme ID: MGYG000004630_00563
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548		62141.77	5.6458

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004630	3004054	MAG	Germany	Europe

• Gene Location: Start: 55423; End: 57069 Strand: -

Full Sequence      

MTKTRERSLAEAPIRLYRALLHVFEKYYWIFFALAVCTLAFFCFRCLDVQYVDSWDEARH
GVNAYEMIQNGDYIRHTYNYQTDDWNLKPSVSYWGIVLGFRLFGYSVLGLRFASALAYLL
TGAVCALFAKRYSKEASILVLAFFCANERPLSAHLARAGDADSLFLLFFTLAMLCMLRIR
ENHKRLYLCGLFFSLAFLTKSWHAGMIAAVGGLYLLGTGELFRLKAKEWGVFLLSVFAPL
LLWFGWRFTKDGFFFLRQMVEVDLLARTGSADFEGHEFPFSFYYDTVFGAEGFIYRWLLL
ICAAGLLCGLVWLWRNRAWKEAWRNGTLPDVLGYLLWFLVPFLGFSVIRTKLIWYCYPCT
VPLALGAAVFLGKVLRAPLALSDSEEAREGSLRPGFLRTSGGMLAAGLAVWLLAAACAAG
TGYYMWNSYLHVIREAHGDPFQLFIQESVDRDSRYAGEKAYVFVPGEDPEEIGSWDQNML
FVAEISGDFHCADGGIEGFLEEEEPAVLYIDAAHYEEYRQTLAGAELLYENGSYLLLGNS
AEQGDTKG

Enzyme Prediction     

No EC number prediction in MGYG000004630_00563.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	31	418	6.3e-56	0.6425925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	5.73e-25	28	382	8	347	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	1.03e-12	88	243	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
PRK13279	arnT	5.17e-12	25	365	4	327	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1928	PMT1	1.32e-04	88	272	90	278	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	3.26e-04	29	230	1	209	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQT05284.1	6.53e-27	37	376	23	365
ALG42265.1	1.49e-14	43	382	29	365
QXI03473.1	1.71e-14	34	383	12	340
AFY33333.1	6.40e-14	21	367	1	327
BAY91775.1	8.32e-14	54	374	32	332

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3KCB9	1.67e-12	56	383	31	339	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT2 PE=3 SV=1
O67270	5.77e-11	48	371	19	321	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q4K884	5.80e-09	33	375	39	364	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT2 PE=3 SV=1
Q4ZSZ0	1.70e-08	34	365	9	326	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=arnT PE=3 SV=1
Q3KCC9	3.03e-08	39	365	30	344	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000022	0.000010	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
27	49
107	129
163	180
195	217
229	246
292	314
326	348
353	375
404	426