CAZyme Information: MGYG000004621_01511

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004621_01511
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398		46174.23	10.0564

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004621	2838817	MAG	France	Europe

• Gene Location: Start: 1080; End: 2276 Strand: +

Full Sequence      

MRKLTWLLLLPAVVSLMAGCTIRSNEIVTVTADSLTYRGQMANGHREGLGVLYEGDSIIY
SGTWHNGLRQGPGWVRDSLGRKIEGQWDHDTLVTGIRRDSAGVYTGEFNRHLQANGYGHY
RDSLGTYYEGQWRDDERTGFGFSSQHRYFRVGEWRRDVYKGERLNYTSERIYGIDLSRYQ
HEKGRHRYGIDWSRIRITHLGSLSKKNVSGNIDYKVSFVFIKSTEGASLINPYYYNDYQM
ARKHGYPVGTYHFFTHRTPGGQQAAFFLAHSHFKQGDLPPVLDLEPLPSQIKKMGGVTAM
WSRVRNWLQIVERRTGMRPILYISQTFVNRYLDYAPDIKRGYPVWIARYGEYKPDVKLWI
WQLAPDGRVSGIHGAVDINVFNGYRNEFSRWLATVRKK

Enzyme Prediction     

No EC number prediction in MGYG000004621_01511.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	190	372	1.1e-39	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06524	GH25_YegX-like	4.88e-45	172	383	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06413	GH25_muramidase_1	4.27e-43	171	383	3	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	1.93e-39	172	381	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
COG3757	Acm	2.34e-37	171	397	63	269	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].
pfam01183	Glyco_hydro_25	1.04e-33	174	372	1	180	Glycosyl hydrolases family 25.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB29361.1	3.86e-195	2	398	19	413
ALO48884.1	2.65e-132	33	392	60	397
QNT67810.1	6.91e-128	99	392	53	347
BCS86499.1	5.20e-126	77	393	36	353
VEH15425.1	1.54e-125	30	396	34	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5A6S_A	1.69e-14	207	392	29	209	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8FFY2	1.47e-34	167	397	63	270	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
Q8X7H0	3.98e-34	167	397	63	270	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P76421	7.72e-34	167	397	63	270	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
P34020	1.15e-09	210	382	11	181	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000068	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004621_01511.