CAZyme Information: MGYG000004621_00470

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004621_00470
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
701	MGYG000004621_10|CGC1	77780.53	7.4818

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004621	2838817	MAG	France	Europe

• Gene Location: Start: 26468; End: 28573 Strand: -

Full Sequence      

MAVALTLLPTAGRAKSIEWYRGGHITYDVQKKHDAVVEKAIALFDSDMQAVTGKNIRQGG
NADVEIFQLNMASNKDLRTLESLKVPFMKFITKKDAFWLGIRDGKMIVVGADGCGTAYGL
LELSRMAGVSPWVWWGDVRPAKRSRLTIDDKFEVTRAPSVALRGINLEQARWQSSDYRHL
LELMLRLRANVLSAGWDGGHMTLPANKTFKVLADSFGIRIAMPHDGNAIRIHEHKKNINV
DITLHDDGYGYLMPTDNALGNGGGMVYHLSYAGRPHDNLWLPATQPGLVVSELHTAYYHG
ANRLWMFSINNPKLLAYPLSLAMDLAWNVNSVSNTRADDHLTAWLAEQFGRPVAERLAQP
MVDFARLTAIRRPDMMDFSEQTTPTKANPTGDGGVRNTEFNAEEFGNELERYINEFQSVS
RRVDEVLSLVDDPLKDAYFAAVQYPVKAASLMAVKQLQAQEARLIGRPASFHHDDEALES
AVRSVMAYRKLQQLNSFYTDSLAGGKWKGWVDLAPRGLALYSRPLLPDTISEDEISRYGN
GGAVDAPLQDDGCIIRQGFEYASGSKGVEEVGLLGRSLRAVTLQRGDSLVYEFSTGTLGG
VLRLAFIPLFSLDGGSSECSIKIDSQAPTTIIINDGARSDRWASAVLRGQSLVSLPVSLK
PGRHTLTVKALHDHVAIDQWMIDRYVNRHFYVFPTGFTRNK

Enzyme Prediction     

No EC number prediction in MGYG000004621_00470.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	244	680	1.5e-60	0.5351506456241033

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	1.11e-36	241	375	194	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.36e-08	574	683	33	159	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB28982.1	6.51e-209	4	695	10	826
ALO48333.1	5.22e-184	1	694	10	719
QIM10033.1	5.64e-148	5	694	10	798
AII65956.1	1.24e-137	15	694	40	855
QJR53583.1	1.24e-137	15	694	40	855

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BY3_A	1.54e-66	36	679	39	770	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4C90_A	6.90e-26	103	683	140	835	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
4ZMH_A	1.00e-25	37	524	35	623	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
7PUG_A	1.80e-23	100	592	111	717	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	7.25e-23	100	592	110	716	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.022468	0.976380	0.000298	0.000346	0.000251	0.000242

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004621_00470.