CAZyme Information: MGYG000004621_00469

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004621_00469
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
865	MGYG000004621_10|CGC1	96683.72	7.4799

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004621	2838817	MAG	France	Europe

• Gene Location: Start: 23809; End: 26406 Strand: +

Full Sequence      

MRRTHQLFLVMALVLAVAPLLPTDAMAGQRRVGQRTMALDASAWNQSVWISAASAPIVKE
SVKDGSRAADGASWFVTTFINKKSLKTARWMTTGLGVYVLYANGHEIGDEMLKPGFTHYA
KTKRAFTYDITDALHTQAATANQLAVQVTPGWWADKIVTPDGHMGMIGNKCAFRGVLELT
YDDGTKELLGTNLNDWKAGVGGPATHAAIFDGETYDARIMPLWQDTRTLSTPELNTEFKG
EILPSDGAEVYLRHDLALSPDRAYVWKDVTGKTDSTYGKVTIVRQYKDGEMVVRPGEHLV
IDFGQNCAAVPDFVFKAKEGTTLTCLPGELLNDGNGAISRGMDGPEGSVHRTNLRIPDKG
MRLVYTFGPGRGYVSFLPECTFFGYRYVTISATSEVRIKSILSIPVTSIARNLETGTVTT
GNPLINQLISNIHWGQRSNYLSVPTDCPQRNERLGWTADTQVFAETGTFFANTDKFFHKW
TRDMRDSQDSLGGFPSVAPAAQYGNETMRLGWADAGVIVPWTIWKQYGDTSIVEQNWAAM
CAFMDRVSRTKYDILANRGQWDFQYADWLSYEPLESCSGKIWARDENGNNVLKADALIYW
NYLSASYWAIDAMMMRDMAMATGRDAGKFQRMADEACNYLREQFLTKDGRFVCDILNTMQ
TPALFALRNHLVDGKAKDDMVTRLRDNFRTHDNCLQTGFLGTSILMQTLTDNGMADIAYE
LLFQRKNPSWLYSVDNGATTMWERWNSYMKDKGMGPKGMNSFNHYAYGCVGQWIWETVAG
IAADPAQPGFRHIIMRPVPDRRLGMLKAEYRSAAGLIRSHWSYKGKQWQWTFTIPKGATA
TVTLPGETTSKDYSSGTYTVTVNLP

Enzyme Prediction     

No EC number prediction in MGYG000004621_00469.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	295	844	9.3e-141	0.9880952380952381
CBM67	49	220	5.5e-16	0.8238636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.52e-97	414	778	2	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	8.50e-30	83	233	1	157	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	2.41e-15	780	851	1	70	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	1.68e-10	293	391	3	85	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT31728.1	0.0	17	861	16	855
ANU59244.1	0.0	32	861	31	855
QQR15843.1	0.0	32	861	31	855
ALJ47829.1	0.0	32	861	31	855
SCV07234.1	0.0	32	861	31	855

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	2.00e-107	83	847	314	997	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	8.18e-87	84	858	143	861	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	2.29e-65	72	845	176	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	8.67e-107	83	847	314	997	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	2.25e-106	88	845	190	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	3.73e-94	77	835	175	869	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	3.28e-41	39	844	141	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000236	0.999097	0.000162	0.000183	0.000148	0.000131

TMHMM  Annotations     

start	end
7	29