CAZyme Information: MGYG000004621_00384

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004621_00384
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
442		49816.82	8.5326

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004621	2838817	MAG	France	Europe

• Gene Location: Start: 11630; End: 12958 Strand: -

Full Sequence      

MTKPLLLLSLLIGVLLPADAQSFVTVNRNRTVTVSARFPKANEVRLRGSLAVEMSRSNLL
KRLNLVPRMLQKEDKVSLENRDGLWSHTSKALPSDLYTYVLSVDGTDTLDVANANKVREV
NTWYNWIIIPGGRGDDYLTRDGIAHGRVETVWYPSSIAGLPRRRMMVYLPPHYDGTRRYP
VLYLLHGAGGDEKSWLELGRATQIMDNLIADKRCKEMIVVMPNGNADRAATPGEDPYNTD
REAASAVPSMFGRIETAFVPDIVNYVDSHYATLADKAHRAIAGLSMGGMHTLFITANNPG
SFDYIGLFSAKIVNEFTKDNRLRRIRRAGEQADNLGHLLPSIVRKGPGNDVLRLKQYADS
GNVAIYDSLDTKLERLFAARPKLYYLAIGDTDFLLDENEAFLTELDKKHYAYTYNPTDGG
HEWMNWRRYLVDFLPRLFLGTE

Enzyme Prediction     

No EC number prediction in MGYG000004621_00384.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	162	436	3.9e-55	0.947136563876652

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	1.60e-23	144	438	65	296	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	1.03e-19	162	437	7	246	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	1.70e-18	155	437	27	308	S-formylglutathione hydrolase FrmB [Defense mechanisms].
cd11294	E_set_Esterase_like_N	1.23e-12	30	130	1	83	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
COG2819	YbbA	2.81e-10	139	334	2	206	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB42247.1	9.50e-92	26	438	24	386
AGH13470.1	2.06e-91	26	438	36	401
ADE82534.1	1.58e-90	78	438	82	400
AHF26056.1	2.97e-88	26	438	37	402
QUB44956.1	2.36e-86	26	438	22	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZN_A	1.71e-80	78	438	62	385	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	1.03e-39	71	438	66	385	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZO_A	5.93e-39	79	314	50	272	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	6.06e-39	79	314	50	272	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6MOT_A	1.54e-35	82	309	52	273	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	2.04e-31	83	438	366	669	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P31471	3.89e-29	83	438	82	388	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EY13	2.28e-28	79	309	431	653	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P10478	1.26e-25	140	310	43	197	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P51584	6.03e-08	163	308	841	974	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000260	0.999044	0.000192	0.000168	0.000166	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004621_00384.