CAZyme Information: MGYG000004599_01069

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola
• CAZyme ID: MGYG000004599_01069
• CAZy Family: GH88
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405		45825.78	4.8245

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004599	3450206	MAG	France	Europe

• Gene Location: Start: 13531; End: 14748 Strand: -

Full Sequence      

MKVNKIIAGLGLLMLSACVSKPTSQIDVDETLHYCDVQIHKTLSSLHSVDSMDYTMMPRN
ILSGETEWNLRKATKEEWTAGFWPGVLWYDYEATGNDSIRDEADKFTRSLEFLAEIPAYD
HDLGFLIFCSYGNGYRLTGNEEYKKVILAVADSLATLYRPAVGAILSWPRNVEMFGGHNT
IMDNMINLEMLFWAAKNGGNKNLYNIAVSHADKTMLNQFRDDYTSYHVAVYDTLTGECIN
RCTHQGYADNSMWARGQAWAIYGYTVVYRETKDPKYLEFAEKVTQVYLDRLPEDYIPYWD
FSSPGIPNAPRDASAACVVASALLELSTFCEGEQADKYKNAAEKMLVSLGSKEYRAGDVN
NSLLLHSTGHWPAGSEIDASIIYADYYYMEALLRLKKLEEGKSIY

Enzyme Prediction     

No EC number prediction in MGYG000004599_01069.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	73	395	7.6e-124	0.9878419452887538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	5.14e-12	70	291	21	222	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU00175.1	8.28e-213	1	403	1	403
QUT34123.1	1.12e-210	1	403	1	403
ALA72154.1	5.06e-210	1	404	1	404
QJR61010.1	5.06e-210	1	404	1	404
AII64635.1	5.06e-210	1	404	1	404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	5.77e-91	56	400	54	393	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	4.60e-56	77	397	67	391	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	4.71e-56	77	397	68	392	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	6.61e-56	77	397	68	392	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	2.55e-55	77	397	68	392	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	1.06e-90	70	398	69	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8DR77	7.76e-58	77	397	66	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9A0T3	6.83e-56	77	397	69	393	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8E372	2.58e-55	77	397	68	392	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9RC92	4.53e-54	77	397	41	366	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000025	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004599_01069.