CAZyme Information: MGYG000004596_00910

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-617
• CAZyme ID: MGYG000004596_00910
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000004596_31|CGC1	36798.94	10.1409

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004596	2214446	MAG	France	Europe

• Gene Location: Start: 7096; End: 8073 Strand: +

Full Sequence      

MTHANRTLPTPAPHNTKAKTCAFALLLLLAGLLPAKAQNAAYQAYINTYKDLAVEQMNKY
GVPASITLAQGLLESGAGRSELVRKSNNHFGIKCGGTWTGPYVLKDDDARNERFRAYKSA
RESYEDHSLFLRNRSRYAFLFRYSPTDYKAWAHGLKKAGYATNPRYAHQLISLIQRYDLD
RFDKLRGKATRPAAVAHGQIAVPGIDLTPSVHLTVRMNNDNYYVIARPGDTYESIGEQMG
VSTRKLRKYNEVPRDYELQAGDIVYFEKKQKKADKAYKGKYHRVAAGESMYVIAQKYGIR
LKTLYENNDLPKDYSPQAGQLLKVR

Enzyme Prediction     

No EC number prediction in MGYG000004596_00910.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	51	179	3.7e-36	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.61e-39	43	187	44	192	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	6.40e-36	43	183	161	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	2.22e-29	39	183	5	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	1.01e-26	50	127	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
TIGR02541	flagell_FlgJ	1.32e-23	61	175	167	291	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR97929.1	2.21e-105	38	324	24	301
ADE83099.1	5.28e-104	39	325	23	303
QVJ81211.1	5.28e-104	39	325	23	303
QJR67483.1	8.97e-104	20	325	5	298
QJR58959.1	8.97e-104	20	325	5	298

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ZYC_A	1.89e-17	43	198	3	162	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3VWO_A	2.93e-17	43	174	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
3K3T_A	1.31e-16	43	198	3	162	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN5_A	1.20e-13	52	176	16	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.63e-13	52	176	16	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	4.94e-18	43	185	49	200	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P15931	4.26e-12	34	176	147	296	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
Q9X9J3	2.44e-11	43	178	161	306	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	1.27e-10	44	178	163	307	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q2G222	1.70e-10	64	186	342	475	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001003	0.997979	0.000377	0.000210	0.000205	0.000195

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004596_00910.