CAZyme Information: MGYG000004596_00622

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-617
• CAZyme ID: MGYG000004596_00622
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
289	MGYG000004596_18|CGC2	34573.73	9.5872

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004596	2214446	MAG	France	Europe

• Gene Location: Start: 13404; End: 14273 Strand: +

Full Sequence      

MRLIKMTGGLGNQMFIYAFFVSMKRRFPSTRIDLSDMVHYHAHHGYELHRIFDLPHDEFC
INQKAKKVVEFLFFKTILERKQDQTTLRTFWRKRLWPLIYFKGFYQSERYFADCADTVRR
LFTFDERRANHRTRQLLTQLQNDPDAVSLHVRRGDYLDPSVWRNTGCVCTLDYYRDAIQA
IRQHVDRPRFYVFSDDIAWVRKNLPLDGATYVDWNHGTDSWQDMLLMSRCRHHVICNSTF
SWWGAWLNPRADKVVIAPARWSALGEMPYICPKNWMQIPVRPADLSPQP

Enzyme Prediction     

No EC number prediction in MGYG000004596_00622.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	3	278	5.5e-73	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	1.08e-67	6	267	7	261	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	7.96e-33	8	263	8	280	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
cd11296	O-FucT_like	0.002	118	243	45	196	GDP-fucose protein O-fucosyltransferase and related proteins. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AND20859.1	1.44e-137	1	280	1	280
QJR76904.1	1.44e-137	1	280	1	280
QUT84300.1	1.44e-137	1	280	1	280
AII69332.1	2.90e-137	1	280	1	280
ALA75149.1	2.90e-137	1	280	1	280

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	6.46e-26	6	278	5	302	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
Q866C7	2.78e-12	97	257	161	327	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Ateles belzebuth OX=9507 GN=FUT1 PE=3 SV=1
Q866C9	3.76e-12	97	257	161	327	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Lagothrix lagotricha OX=9519 GN=FUT1 PE=3 SV=1
Q866E8	3.76e-12	97	257	161	327	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Sapajus apella OX=9515 GN=FUT1 PE=3 SV=1
P19526	5.05e-12	97	257	160	326	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Homo sapiens OX=9606 GN=FUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004596_00622.