CAZyme Information: MGYG000004594_00541

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UMGS1663
• CAZyme ID: MGYG000004594_00541
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	MGYG000004594_3|CGC2	36779.42	9.3863

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004594	1579058	MAG	France	Europe

• Gene Location: Start: 128806; End: 129744 Strand: +

Full Sequence      

MEIGVVLVTFNRLEKLKIALEAYERQTVKPKYILVVDNNSTDGTREYLENWKKEEKQYKK
YTVFMEKNTGGSGGFYEALKHSLELDASWIWTADDDAYPKEDAFEVAIRYLKEKEEKNQL
DNISAICGTVFKADGKTIDYSHRRRIYTSYCNRIKQPYSKQKDYEKEEFEIEGFSYVGTF
INKEKMKQLPLTKKDYFIYYDDTEHSYRLSKIGKIICVPKIQVVHDAPHSDMSSIVKWKL
YYLVRNTLDFIKNNFDEKYFKMACIEVPIKFKIAVLLFGKEKKKGYAMIKEALKDAKKGK
TGLHEIYKPGWK

Enzyme Prediction     

No EC number prediction in MGYG000004594_00541.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	174	1.9e-20	0.9176470588235294

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04185	GT_2_like_b	6.87e-58	5	248	1	200	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.18e-33	1	301	3	286	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	3.61e-17	5	163	2	148	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd02526	GT2_RfbF_like	7.15e-14	5	248	1	234	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
cd04186	GT_2_like_c	7.68e-14	5	225	1	164	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJA50745.1	3.14e-95	1	312	1	305
AOZ77948.1	3.14e-95	1	312	1	305
AOZ74151.1	3.14e-95	1	312	1	305
ADQ61858.1	5.58e-91	1	312	1	302
AOR63326.1	7.69e-73	1	312	1	297

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R5Z2	3.33e-09	6	99	10	98	Galactofuranosyltransferase GlfT1 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004594_00541.