CAZyme Information: MGYG000004589_01653

Basic Information

• Species: UBA2856 sp009696445
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA2856; UBA2856 sp009696445
• CAZyme ID: MGYG000004589_01653
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548	MGYG000004589_66|CGC1	62756.18	6.6319

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004589	2344590	MAG	France	Europe

• Gene Location: Start: 6897; End: 8543 Strand: +

Full Sequence      

MNLGKLKNYLNLFSLQQAAVSIRDRFFAPEHEEVPYERWLEHTRISSRGYAKISKEVFHF
QPTIGVYAHAEGRDRAAFVQSLSLQTYRNVRPLKDCPEAEYTLFAGPGCTLTPDMLSSCV
RLLNEDNGGYVDLVYFDSDCIDAEGRKTNPAFRPEYDPILLRKVNYMGNVFLVRTALFRK
VYGEMERDSGGKVSLDSDGVHAFLKRLCKGERVRPGQERSGTVRHIPRILYHEVLENARK
VSVDRHIPLLKKDLELVSVIIPNKDHVRDLKSCIDSLLEVNAYHNLEIIIVENNSSSPEI
FQYYEEIQKRDERIHVYTYTGSFNYSRINNFGASKAHGRFLLFLNNDTVILKPSSIWYLA
SHAERQDVGAVGALLIYPDHTVQHAGVILGYGGIAGHAYQGEELGELPGEYPELLFEHTR
NVSAVTGACMLMRREVYEQAGGFDEELAVTFNDVDLCLRLRQEGYRILICPNAELIHNES
ASRGAEDSEEKVRRFHREIGIFVRRWEKELEAGDPFYNPNLTLTGRTYTCKDPVREARAP
YLKYLRME

Enzyme Prediction     

No EC number prediction in MGYG000004589_01653.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	257	478	3.4e-19	0.9043478260869565

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	1.08e-40	259	477	1	164	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	4.65e-29	257	508	5	250	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04184	GT2_RfbC_Mx_like	2.09e-16	100	232	85	199	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd00761	Glyco_tranf_GTA_type	2.45e-16	259	469	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	6.53e-16	258	437	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO33456.1	3.57e-104	84	531	349	811
QOV20101.1	1.42e-99	2	531	17	604
SET95770.1	2.12e-99	5	536	116	720
QBE99396.1	7.35e-99	70	531	335	814
QOV20089.1	2.71e-98	15	531	239	812

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.27e-64	111	533	461	900	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.33e-61	100	524	403	834	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P9WMY2	4.34e-08	346	503	99	260	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	4.34e-08	346	503	99	260	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004589_01653.