CAZyme Information: MGYG000004588_00053

Basic Information

• Species: Prevotella sp900317685
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900317685
• CAZyme ID: MGYG000004588_00053
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
823		94033.02	7.6632

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004588	3452051	MAG	France	Europe

• Gene Location: Start: 71109; End: 73580 Strand: -

Full Sequence      

MNKIILFLLLLSPLLAKAADFYIAKPGQQPATIVVDTTDWTGVRLATRDLSADIGRVCGK
AAPILVTTAAYQPGQGRIIAGTLGKSKVISNIVKAHKIDVRKLRGQWESYLIDVVDGNLI
VIGSDKRGTIYGIYELSREMGVSPWYWWADVPVKHQDHIIYSNGRQYQPSPRVKYRGIFL
NDEAPCLTTWVKNTYGTNYGGHRFYDRVFELLLRLKANFMWPAMWSWAFYADDPLNSKTA
DDRGIIIGTSHHEPMCRSQKEWHNHTDDPNVEPQDRASREAAGGQWNYATNQKALDEFWA
GGVRRNKGTEDIVTIGMRGDGDMAMSEDTNIQLMEKIIRNQRRIIEKERGKKASEVPQVW
ALYKEVMYYYDAGLQVPDDVTLLLCDDNWGDVRRVPTPKERNRKGGWGLYYHVDYVGAPR
NSKWINVTPIQNMWEQLTLAAENGIDRLWILNVGDLKPMEYPIQLFIDMAWNPTVYTTEN
LLDHTRRFCAAAFGEDQATEAARILNLQCKYAGRCTAEMLDAKTYNLKDGEWQKVVSDYT
ALERDALRQYTSLPENCRDAYQELILFPVQAMANLYDMYYAQAMNHQLYEQGNPDANTWA
ERCRKDFRRDSLLCAAYNHDIAGGKWNGMMIQKHIGYTTWNDNFPHDMLPKLYTVKPRTD
GWVIDEKDGKVVLEAGHYFSKRDGEGARWIDIPFMGPSLGAMTLRPTTASVKGAQLEYWF
RGLDSTDSMTVTVTTKSTLDFLNQGGLRYRVSLDGKSQTVNFNANLNEKPENIYSIYYPT
VARRIVEKQVTLPRQKVSDGIHKLVFEPLDLGVVLEKITIKTK

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	27	818	7.5e-269	0.9870875179340028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	170	519	2	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	7.10e-27	666	820	4	158	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	0.007	46	136	36	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG34758.1	0.0	32	820	10	783
BCS85271.1	0.0	2	820	6	813
AGB29053.1	0.0	17	820	36	816
QNL40611.1	0.0	30	820	41	823
QUR44901.1	0.0	30	820	41	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	0.0	30	820	52	834	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	5.71e-318	30	820	25	819	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	4.14e-315	30	820	24	818	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	4.71e-184	31	655	23	633	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	9.56e-106	78	676	65	679	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000364	0.998805	0.000244	0.000180	0.000191	0.000175

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004588_00053.