CAZyme Information: MGYG000004587_01338

Basic Information

• Species: UBA1409 sp900553675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1409; UBA1409 sp900553675
• CAZyme ID: MGYG000004587_01338
• CAZy Family: GH98
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
756	MGYG000004587_11|CGC1	85893.25	7.5593

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004587	2560840	MAG	France	Europe

• Gene Location: Start: 59518; End: 61788 Strand: +

Full Sequence      

MKLKRFVLLLTAVIVAISVLPLTAFAEESEKTSSKQELRRPVSPEQPMWIVHIDTWNYAD
PAKIIDLIPEDILPYVVFNISMSINYDHETHTWGMVNDGYELAKSWLRTCAEKNVWALIQ
PASGGQCHFKDYPNCGLEGTLFEEFFRDYPNFLGFNYCEQFWGFEQKDFPVTPVQRYKHF
ANLLELTNKYGGYLVVSWCGNQWGQNINPIAMLKRVSEFEEACRKYTENFILCEKYTQVG
YIQDAESICLGAYLSGYAGQYGIRYDSTGWTNSEGKNEDFTLATGLSTHIEKLMHSGLTV
IDGPELIWQQDFMEKWGGTKTSDGYTSRQWEMFDQFQNVMIDMFRKVIGGSIRIPGREEV
IKNTKVAVVQDYKLNSNASDDAKFCSPESLFEGLYQMADDGALRDNHNFFKSTGRYPAIP
VVYGLADDIAKGFEVKISALEYDKKWGNVRTKISKFNELFPKEYTGDIYARRNENSWTIY
NPFKTGKKATGRIQFKYNTSDRIELSLSRYSAGIINEYPDKVDIYINNYDNELDKSTVLK
KDVFKIYGASSEPKITYKDRGVNQSKSKVTKSWKNGVLTVSVSHNGPVDLTISCSGDAEG
RLTKYTKSDIIAPKRPPLYYGDRQYEAEHFEYKNVSKVVTNGCRTGVDKFTGQGYMIFGR
SSNAAVKDTISVLEAGEYILNLRYAIKGSNANNLSLYINGRLVSSPSLKKTGSISKWGTY
KVKVNLNKGENTFELKAVSSASEDIYLDNIVISKAK

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH98	37	352	1.7e-128	0.9877675840978594
CBM35	641	750	1.5e-20	0.8907563025210085

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08306	Glyco_hydro_98M	5.84e-144	37	352	6	328	Glycosyl hydrolase family 98. This domain is the putative catalytic domain of glycosyl hydrolase family 98 proteins.
cd04083	CBM35_Lmo2446-like	1.41e-28	623	752	1	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
pfam08307	Glyco_hydro_98C	2.64e-13	357	529	1	167	Glycosyl hydrolase family 98 C-terminal domain. This putative domain is found at the C-terminus of glycosyl hydrolase family 98 proteins. This domain is not expected to form part of the catalytic activity.
cd04082	CBM35_pectate_lyase-like	1.91e-12	625	741	3	114	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
cd02795	CBM6-CBM35-CBM36_like	5.82e-09	624	752	1	124	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL51037.1	1.70e-289	16	753	47	779
BAV13045.1	1.70e-289	16	753	47	779
BAV06735.1	1.70e-271	38	755	34	749
AXY74108.1	4.06e-266	29	752	24	748
AOZ99817.1	2.90e-265	38	754	36	743

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WMH_A	1.84e-21	143	592	134	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 in complex with the H- disaccharide blood group antigen. [Streptococcus pneumoniae TIGR4]
2WMF_A	3.23e-21	143	592	134	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 (Sp4GH98) in its native form. [Streptococcus pneumoniae TIGR4]
2WMG_A	1.32e-20	179	592	162	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 (Sp4GH98) in complex with the LewisY pentasaccharide blood group antigen. [Streptococcus pneumoniae TIGR4]
4D6C_A	5.78e-16	68	621	46	598	Crystalstructure of a family 98 glycoside hydrolase catalytic module (Sp3GH98)(L19 mutant) [Streptococcus pneumoniae SP3-BS71],4D6G_A Crystal structure of a family 98 glycoside hydrolase catalytic module (Sp3GH98) in complex with the blood group A-trisaccharide (L19 mutant) [Streptococcus pneumoniae SP3-BS71]
4D6E_A	7.64e-16	68	621	46	598	Crystalstructure of a family 98 glycoside hydrolase catalytic module (Sp3GH98) in complex with the blood group A-trisaccharide (X01 mutant) [Streptococcus pneumoniae SP3-BS71]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6RUF5	8.07e-16	68	534	262	703	Blood-group-substance endo-1,4-beta-galactosidase OS=Clostridium perfringens OX=1502 GN=eabC PE=1 SV=1
P94286	2.44e-09	589	754	709	872	Cycloisomaltooligosaccharide glucanotransferase OS=Niallia circulans OX=1397 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000572	0.998198	0.000441	0.000319	0.000247	0.000191

TMHMM  Annotations     

start	end
7	26