CAZyme Information: MGYG000004587_00746

Basic Information

• Species: UBA1409 sp900553675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1409; UBA1409 sp900553675
• CAZyme ID: MGYG000004587_00746
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
189	MGYG000004587_5|CGC1	21915.71	4.2836

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004587	2560840	MAG	France	Europe

• Gene Location: Start: 125468; End: 126037 Strand: -

Full Sequence      

MIKRIFAFMLAVGFVALLAVFLFVYMPYWFKNESYPTEYEDIVERYSEEYGIDKEFVFAV
IRTESNFNPDAVSEAGAIGLMQIIEDSFDWVSKKLGREDLVFDDMFSPEYSIEYGCFMLG
YLYNRFGSYELAAAAYHSGMGEVSSWIASGEVDAENPNINDFKGSNTRHYVNKIMRAYNK
YSELEERNK

Enzyme Prediction     

No EC number prediction in MGYG000004587_00746.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	55	185	4.8e-30	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.03e-60	36	180	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.01e-42	35	184	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	9.57e-32	55	179	2	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16893	LT_MltC_MltE	2.89e-29	41	179	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
COG0741	MltE	7.52e-28	4	181	112	283	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO04775.1	7.79e-43	34	184	55	209
ADU24393.1	1.26e-41	34	184	70	223
CBK96310.1	6.87e-39	10	184	15	195
CBL34880.1	2.75e-38	10	184	15	195
AYH39946.1	3.78e-38	15	186	26	195

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	1.89e-11	35	175	445	586	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	1.92e-11	35	175	474	615	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	4.72e-11	35	175	445	586	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	4.73e-11	35	175	446	587	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
5MPQ_A	5.99e-09	35	184	412	558	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C5BCE9	2.08e-10	38	156	190	318	Membrane-bound lytic murein transglycosylase C OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=mltC PE=3 SV=1
O31608	3.36e-09	40	178	61	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
A8GJ50	6.01e-09	38	181	190	355	Membrane-bound lytic murein transglycosylase C OS=Serratia proteamaculans (strain 568) OX=399741 GN=mltC PE=3 SV=1
A6TDX1	6.03e-09	38	156	192	320	Membrane-bound lytic murein transglycosylase C OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=mltC PE=3 SV=2
B5XU88	6.03e-09	38	156	192	320	Membrane-bound lytic murein transglycosylase C OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999505	0.000359	0.000071	0.000002	0.000001	0.000099

TMHMM  Annotations     

start	end
7	29