CAZyme Information: MGYG000004585_01813

Basic Information

• Species: Methanobacterium sp000499765
• Lineage: Archaea; Methanobacteriota; Methanobacteria; Methanobacteriales; Methanobacteriaceae; Methanobacterium; Methanobacterium sp000499765
• CAZyme ID: MGYG000004585_01813
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
583		67204.75	5.4495

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004585	1905101	MAG	France	Europe

• Gene Location: Start: 2773; End: 4524 Strand: -

Full Sequence      

MKLSIIIPTFNEEDYLPNLLESIKRQDFQDYEVIVADAGSTDKTREIAKEFGCKIVEGGL
PAVGRNRGAEVAQGEYFLFLDSDVILTKDYLELCLNEFQERELGIAITQIAPLSDGFLNK
ITHDFANFFMRKVEKIKPHGAGCYGIVTTKKLHEEVEGFDEDLDFGEDTDYIERIGAISQ
FKVLRSPKLLVSTRRLQEEGLRNVAFKYVKSTFYQFRGKQVTAADLDYTFGHPNTKRIIY
SVCGEGMGHAIRAKVILHHLTKKHEVHIFASDRAYTYLSQHFDNVYEIGGFNTVYEDNEV
QNTKTFIKGMKDLPGDLKKSLRLMYSVAKAVKPQVIISDFEFYSNLLSKILRLPLISLDN
MHVLTQAELDVPSEFRTERIAAEGVVRSFIQLPAVYLITSYFYPPLKNPEKSKYFPPVLR
EEIMNLKPYKGDHVLVYQTSDSNWKLLEILKKFDDEFIVYGFHQEGRDENLRFKKFNEDE
FFQDLAQARAVITNGGFTLISEALYLGKPVLSVPVKKQFEQILNAIYLERLGYGEFHQDL
EEEDIANFLSNLEKYRKNIDLTFKHDNNQSILEELDLLLDKYA

Enzyme Prediction     

No EC number prediction in MGYG000004585_01813.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	124	2.4e-28	0.7588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13528	Glyco_trans_1_3	3.60e-119	237	552	2	320	Glycosyl transferase family 1.
TIGR00661	MJ1255	3.32e-99	237	558	1	318	conserved hypothetical protein. This model represents nearly the full length of MJ1255 from Methanococcus jannaschii and of an unpublished protein from Vibrio cholerae, as well as the C-terminal half of a protein from Methanobacterium thermoautotrophicum. A small region (~50 amino acids) within the domain appears related to a family of sugar transferases. [Hypothetical proteins, Conserved]
cd02522	GT_2_like_a	1.36e-38	3	210	1	203	GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function. Glycosyltransferase family 2 (GT-2) subfamily of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1819	YjiC	1.14e-34	236	559	2	375	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd02525	Succinoglycan_BP_ExoA	3.19e-31	4	191	3	205	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDG65534.1	0.0	1	583	1	583
AXV40773.1	0.0	1	583	1	583
CEL25342.1	0.0	1	583	1	583
AIS31485.1	0.0	1	583	1	583
CEA12996.1	0.0	1	583	1	583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TZE_C	1.28e-12	1	92	1	102	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	2.54e-12	1	92	1	102	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]
5HEA_A	1.01e-10	3	124	7	138	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
6P61_A	1.21e-09	4	142	16	153	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]
2Z86_A	4.94e-09	4	182	378	562	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58652	8.09e-16	237	576	2	363	Uncharacterized glycosyltransferase MJ1255 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1255 PE=3 SV=2
A0A0H3JPC6	1.40e-11	1	92	2	103	Poly(ribitol-phosphate) beta-N-acetylglucosaminyltransferase TarS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=tarS PE=1 SV=1
A0A0H3JVA1	1.40e-11	1	92	2	103	Poly(ribitol-phosphate) beta-N-acetylglucosaminyltransferase TarS OS=Staphylococcus aureus (strain MW2) OX=196620 GN=tarS PE=1 SV=1
Q57022	5.56e-11	3	103	6	114	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1
O32268	5.71e-11	4	123	9	138	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004585_01813.