CAZyme Information: MGYG000004585_01603

Basic Information

• Species: Methanobacterium sp000499765
• Lineage: Archaea; Methanobacteriota; Methanobacteria; Methanobacteriales; Methanobacteriaceae; Methanobacterium; Methanobacterium sp000499765
• CAZyme ID: MGYG000004585_01603
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		42999.04	8.9886

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004585	1905101	MAG	France	Europe

• Gene Location: Start: 39068; End: 40213 Strand: -

Full Sequence      

MKVLLIPCGIGMGHTSRAVALAQKLEKRGDEVLFASYGSGYQMLSEYSDYQVMKLPPIKF
YGNSGELDFKHTARKSIDVPYVFLKSIYYESRIIKDFNPDVVVSDSHYSVPITCKVLGIP
CVMVSNDLAPELKEDPHKDRTLEYLETGLQRFIKDVSRLCSSIIVPDVVNSYEIPPTIRD
RVHFTGPILKMNPQTMESKEKLRRRFGFKKNDKIIMATVGGSEFGKKLLNLLYQAAPQLD
CDQMILVTGPNIDLKIPSAPGIIFKRFLGDIMEWMKLSDFLVSLAGHTTSMEIASLGIPS
LMVPIENHPEQQRNARNMMKYGLARVQKMGTLSIDSLTDNINYLLKNQDLKINARKTRDI
FSRYNGTDTAVDIIQNCVARS

Enzyme Prediction     

No EC number prediction in MGYG000004585_01603.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	219	350	2.3e-19	0.8662420382165605

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03785	GT28_MurG	8.90e-37	2	356	1	337	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG1819	YjiC	1.25e-29	1	381	2	402	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
TIGR00661	MJ1255	2.21e-28	2	326	1	296	conserved hypothetical protein. This model represents nearly the full length of MJ1255 from Methanococcus jannaschii and of an unpublished protein from Vibrio cholerae, as well as the C-terminal half of a protein from Methanobacterium thermoautotrophicum. A small region (~50 amino acids) within the domain appears related to a family of sugar transferases. [Hypothetical proteins, Conserved]
COG0707	MurG	9.19e-27	1	380	1	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK00726	murG	7.51e-21	13	380	13	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDG65339.1	1.50e-279	1	381	1	381
AXV40963.1	8.41e-261	1	381	1	381
AIS31274.1	2.31e-258	1	381	1	381
CEA12741.1	2.31e-258	1	381	1	381
CEL25122.1	2.31e-258	1	381	1	381

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8TWQ5	2.56e-37	19	323	1	295	Uncharacterized glycosyltransferase MK0977 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) OX=190192 GN=MK0977 PE=3 SV=1
Q8PWF3	1.01e-35	1	375	1	371	Uncharacterized glycosyltransferase MM_1636 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) OX=192952 GN=MM_1636 PE=3 SV=1
Q8TTI1	1.36e-32	1	331	1	328	Uncharacterized glycosyltransferase MA_0452 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) OX=188937 GN=MA_0452 PE=3 SV=1
Q58652	2.94e-29	1	374	1	362	Uncharacterized glycosyltransferase MJ1255 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1255 PE=3 SV=2
Q8PZB2	2.00e-27	1	325	1	322	Uncharacterized glycosyltransferase MM_0582 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) OX=192952 GN=MM_0582 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004585_01603.