CAZyme Information: MGYG000004581_01405

Basic Information

• Species: Coprococcus_A sp900548825
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Coprococcus_A; Coprococcus_A sp900548825
• CAZyme ID: MGYG000004581_01405
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573	MGYG000004581_33|CGC1	66274.4	9.8318

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004581	2727117	MAG	France	Europe

• Gene Location: Start: 1396; End: 3117 Strand: +

Full Sequence      

MYRHKKNRHRYYKIKHLTDIFIGFILSVLMIPLFLIIGISIVIEDGFPVIFKQKRFGINR
SFFEIYKFRTMRRHTPHDCPTHLLKDPDQYLTKVGRFLRQYSLDELPQFINIAKGEMSFV
GPRPALWNQTDLIRERERYGANSIFPGLTGWAQIHGRDTLEIKDKAAYDGYYVQHLSFFL
DLKCLFGTVIAVLERKGFMEGGTGNKDHPVKHKLIICTNHSYMFYQFHRELIEALADSYR
ILLITPFTGHIKELADAGANCKRTVIDRRGCNPFKDTRLLIDYLRLFRREKPDLVITYSI
KPNIYAGILCRVLNIPYCTNIQGLGTAFQKEPIEKWVTALYRYALKKASVVFFENRANAH
LFLKKRIAAPGQIKVLPGAGVNLRQYAYHPCHRGRKVIHFLYLGRLMKEKGIDELLTAFC
FLHHKYGSRVLLDVVGFFEEAYREKLRQLTSLGIVIFHGFQKDPIPFYCNSDCVLLPSYH
EGMSNVLLEAAAIGRPVISSDIPGCREAVLDKVSGYLCQPGNSQSLYQKMDAFMQLDEEH
RILMGLAGRQHMEVNFDRRNVVAKTSQILRTTT

Enzyme Prediction     

No EC number prediction in MGYG000004581_01405.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	400	544	1.1e-30	0.9125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03808	GT4_CapM-like	3.06e-101	213	566	1	358	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
pfam02397	Bac_transf	1.16e-70	15	193	1	180	Bacterial sugar transferase. This Pfam family represents a conserved region from a number of different bacterial sugar transferases, involved in diverse biosynthesis pathways.
COG2148	WcaJ	3.13e-70	10	197	36	224	Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) [Cell wall/membrane/envelope biogenesis].
TIGR03025	EPS_sugtrans	4.75e-56	14	197	257	443	exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase. Members of this family are generally found near other genes involved in the biosynthesis of a variety of exopolysaccharides. These proteins consist of two fused domains, an N-terminal hydrophobic domain of generally low conservation and a highly conserved C-terminal sugar transferase domain (pfam02397). Characterized and partially characterized members of this subfamily include Salmonella WbaP (originally RfbP), E. coli WcaJ, Methylobacillus EpsB, Xanthomonas GumD, Vibrio CpsA, Erwinia AmsG, Group B Streptococcus CpsE (originally CpsD), and Streptococcus suis Cps2E. Each of these is believed to act in transferring the sugar from, for instance, UDP-glucose or UDP-galactose, to a lipid carrier such as undecaprenyl phosphate as the first (priming) step in the synthesis of an oligosaccharide "block". This function is encoded in the C-terminal domain. The liposaccharide is believed to be subsequently transferred through a "flippase" function from the cytoplasmic to the periplasmic face of the inner membrane by the N-terminal domain. Certain closely related transferase enzymes, such as Sinorhizobium ExoY and Lactococcus EpsD, lack the N-terminal domain and are not found by this model.
TIGR03023	WcaJ_sugtrans	4.31e-49	14	193	259	444	Undecaprenyl-phosphate glucose phosphotransferase. This family of proteins encompasses the E. coli WcaJ protein involved in colanic acid biosynthesis, the Methylobacillus EpsB protein involved in methanolan biosynthesis, as well as the GumD protein involved in the biosynthesis of xanthan. All of these are closely related to the well-characterized WbaP (formerly RfbP) protein, which is the first enzyme in O-antigen biosynthesis in Salmonella typhimurium. The enzyme transfers galactose from UDP-galactose (NOTE: not glucose) to a polyprenyl carrier (utilizing the highly conserved C-terminal sugar transferase domain, pfam02397) a reaction which takes place at the cytoplasmic face of the inner membrane. The N-terminal hydrophobic domain is then believed to facilitate the "flippase" function of transferring the liposaccharide unit from the cytoplasmic face to the periplasmic face of the inner membrane. Most of these genes are found within large operons dedicated to the production of complex exopolysaccharides such as the enterobacterial O-antigen. Colanic acid biosynthesis utilizes a glucose-undecaprenyl carrier, knockout of EpsB abolishes incorporation of UDP-glucose into the lipid phase, and the C-terminal portion of GumD has been shown to be responsible for the glucosyl-1-transferase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO34429.1	3.73e-125	213	565	2	353
ANU78758.2	3.16e-124	199	565	1	371
QQQ95319.1	3.16e-124	199	565	1	371
ASU30524.1	3.16e-124	199	565	1	371
QJU16507.1	3.16e-124	199	565	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W7L_A	2.67e-34	14	202	10	194	Structureof Campylobacter concisus PglC I57M/Q175M variant [Campylobacter concisus 13826],5W7L_B Structure of Campylobacter concisus PglC I57M/Q175M variant [Campylobacter concisus 13826]
2JJM_A	7.02e-08	401	568	215	381	CrystalStructure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_B Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_C Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_D Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_E Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_F Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_G Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_H Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_I Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_J Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_K Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_L Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames]
3MBO_A	7.42e-08	401	568	235	401	CrystalStructure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis],3MBO_B Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis],3MBO_C Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis],3MBO_D Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis],3MBO_E Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis],3MBO_F Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis],3MBO_G Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis],3MBO_H Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis]
5D00_A	4.83e-07	401	568	205	371	Crystalstructure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D00_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D01_A Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168],5D01_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0P9D0	3.34e-33	15	202	7	189	Undecaprenyl phosphate N,N'-diacetylbacillosamine 1-phosphate transferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglC PE=1 SV=1
P71062	1.63e-31	43	200	32	185	Uncharacterized sugar transferase EpsL OS=Bacillus subtilis (strain 168) OX=224308 GN=epsL PE=2 SV=1
Q02731	8.06e-25	15	197	29	224	Exopolysaccharide production protein ExoY OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exoY PE=3 SV=1
Q48460	1.82e-24	15	200	275	461	UDP-glucose:undecaprenyl-phosphate glucose-1-phosphate transferase OS=Klebsiella pneumoniae OX=573 PE=3 SV=1
P14186	2.05e-24	15	197	29	224	Exopolysaccharide production protein ExoY OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=exoY PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999993	0.000026	0.000000	0.000000	0.000000	0.000005

TMHMM  Annotations     

start	end
21	43