CAZyme Information: MGYG000004573_01798

Basic Information

• Species: F082 sp002633315
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; F082; F082; F082 sp002633315
• CAZyme ID: MGYG000004573_01798
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	MGYG000004573_29|CGC1	46105.3	4.9668

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004573	2473880	MAG	France	Europe

• Gene Location: Start: 9779; End: 10987 Strand: -

Full Sequence      

MKRLLTLLLLITGLSCFAQVESDFEKFKREQQEQLKAMKDSQNDEIKAMIKEYDDYVKAE
KEAYNAFVKKMSALWGEDNVTESTQTNWVEYYDDGKTRSDVDFENGEATIEIILDEDTSQ
ESKEEEQSIIENKIENSVKRLLITKGKTKDYDTPMEKAVPLQSEAVLENQVQTPSGKMVT
EETVEEDAKEIAAAMVPEVKTIKGSDGKERKVVTVKLDLVPDHLRTRAEQYKNEVEKYCN
MYDLEPALVYAVIQTESAFNPKAKSHVPAYGLMQIVPNSAGKDCAQSLKKPFDKPTANYL
YEPNNNIEMGVHYLYLLRKRYFNKVTDTDKSVLCMIASYNTGAGNLARALRGDTNISKAI
PKINEMSYKELFSYLEKHLLPETQNYIRRVSSRMDDFNKWIK

Enzyme Prediction     

No EC number prediction in MGYG000004573_01798.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	245	396	7.7e-22	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	1.08e-68	235	394	3	161	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK11671	mltC	2.54e-45	74	392	51	351	membrane-bound lytic murein transglycosylase MltC.
cd13401	Slt70-like	3.13e-35	231	390	6	142	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	8.84e-33	231	390	4	140	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	3.10e-26	237	353	3	106	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCG64024.1	1.54e-51	70	394	72	396
QSZ42243.1	3.28e-50	83	398	72	384
ALS34875.1	3.49e-50	3	402	10	403
ACO04855.1	1.06e-49	7	399	5	394
ADG92266.1	1.33e-48	69	397	71	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C5F_A	1.46e-27	74	399	33	340	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
4CFO_A	3.82e-27	74	399	33	340	Structureof Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFO_B Structure of Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFP_A Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CFP_B Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CHX_A Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli],4CHX_B Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli]
6GI4_B	4.70e-17	227	395	18	184	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]
2Y8P_A	8.80e-17	227	395	18	184	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	1.06e-16	227	395	35	201	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3N339	8.47e-39	74	397	59	361	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) OX=416269 GN=mltC PE=3 SV=1
B3GYW8	8.47e-39	74	397	59	361	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) OX=537457 GN=mltC PE=3 SV=1
B0BSH0	8.47e-39	74	397	59	361	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) OX=434271 GN=mltC PE=3 SV=1
A5UDW4	1.93e-38	71	397	48	353	Membrane-bound lytic murein transglycosylase C OS=Haemophilus influenzae (strain PittEE) OX=374930 GN=mltC PE=3 SV=1
A5UHR5	1.40e-37	71	397	48	353	Membrane-bound lytic murein transglycosylase C OS=Haemophilus influenzae (strain PittGG) OX=374931 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001174	0.726105	0.271927	0.000293	0.000242	0.000232

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004573_01798.